SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012651 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012651
Domain Number 1 Region: 293-489
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-44
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 2 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.37e-36
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 3 Region: 515-586
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000000379
Family Kelch motif 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012651   Gene: ENSGMOG00000011827   Transcript: ENSGMOT00000012985
Sequence length 587
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3080:168789:175588:1 gene:ENSGMOG00000011827 transcript:ENSGMOT00000012985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAAMATVSPEQVSFASDRYARIILAQMNRMRLRADFCDVRLRVGERVFRVHRLVLAACSP
YFCALFSVGMKELDKDEVQILGVEAGIFEVLLDFIYTGVINVSVENVQELMVAADMLQLA
EVVSICGEFLQGHMEPSNCVGIFQFLEQIGCMDMLEFTENYIHVHFLEVCVADEFWGLSK
DQLVRLLGSEELRVEEEYQVFSAAMGWLLQDVGPRRRHAVEVLEPVRFPLLSPRRLLKYI
EGVADFSLRVALQTLLKEYMEVTKSPKENKPYCVGEPSKMRPRRKARKYLYSIAGGYTRL
QGGRWSDSRALSCVERFDSFNQYWTTVSSLHQARSGLGVAVLDGXXXXXXXPGEKDSMIF
DCTERYDPVTKQWAAVASLTFPRCGVSVCPCHGALYAFGGWIGSEIGKTVERYDPEENKW
EVIGSMAVPRYYCGCCELQGMMYVLGGISDDGLELCSAEVFDALSQRWRPLPPMATRRAY
VGVAALNNCXXXXXXXXXXXXXXXXXXXXXXXXERWVEVASMCTARAGVSVAAVNGLLYA
VGGRATSRDFSAPVTVDSVEVYDPHLDTWTEVGNMIASRCDGGLAVL
Download sequence
Identical sequences ENSGMOP00000012651 ENSGMOP00000012651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]