SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012697 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012697
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 1.29e-68
Family Kelch motif 0.0000467
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 1.37e-31
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012697   Gene: ENSGMOG00000011878   Transcript: ENSGMOT00000013033
Sequence length 600
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3660:113441:128326:1 gene:ENSGMOG00000011878 transcript:ENSGMOT00000013033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREESETRDSPAVKRKIFEVDPKTLNSQDAFDFNCGSVHSEAILQVFNEFR
DCRLFTDVIISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMDSF
LSFVYSGRAKITTENVQFLFETSSLFQIATLRDACAKFLEDQLDPCNCLGIQRFADDHAL
KHLASRCRVYALANFAEVAHHEEFLDLRREELEEYTASDELAVGKEEMVFEAVMRWVYHS
LEQRKPMLKELLHHVRMPLLHPNYFVQTVEGDHLIQNAPECYQLLHEARRYHVLGNEMMS
PRTRPRRSTGFSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSMAKLPEFTKSEYAVCA
LRNDILVSGGRLNSRDVWMYNSQLNFWIRVASLNKGRWRHKMAVLLGKVYAVGGYDGQTR
LTSAECYDSFSNRWTEVASMKEAVSSPAVASCAGKLFVIGGGPDDNTCSDKVQCYDPEED
TWMLRANIPIAKRCITAVSLNNLIYVAGGLTKSIFCYDPVEDYWMHVVHTFSKLESCGMS
VCNGKLFILGGRGESGEASDGIVCYDPASGIITGVAAMPRPISYHGCVTIHRYNEKFHKP
Download sequence
Identical sequences ENSGMOP00000012697 ENSGMOP00000012697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]