SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012824 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012824
Domain Number 1 Region: 327-492
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-28
Family Kelch motif 0.001
Further Details:      
 
Domain Number 2 Region: 60-174
Classification Level Classification E-value
Superfamily POZ domain 9.42e-21
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012824   Gene: ENSGMOG00000011985   Transcript: ENSGMOT00000013162
Sequence length 496
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4591:81389:86823:1 gene:ENSGMOG00000011985 transcript:ENSGMOT00000013162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKRASRQKKSPAGVSPAPAVAVAMDASSLKLNSLNLPLLPPAVKPGERGLGLGCELT
RPLHGNALLEELSKMRQERFLTDLELACKSKAFDVHKLVISSVSQYFREILAKDPGMKRL
ELPSLSPLGLANVITFAYLGRVHMSLYTIGCTLSAATTLQIPQLLKMCMDFLLAELNLTT
CVYVWNIAAAYGLLPVRDAARRFVLDNFVPFSETALFNQLTLEQISAFLRDDSLVLPSEV
VAFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQPVARMMLDPQCHRLLVDA
MNYHLLPYQQNTLQSRRTQVRGGQQTLLTIGGRPSITERALSREVLWRDPREGAATWRHL
SQLPAKSFNQCVAVMDGFLYVAGGEDQNDARNQAKHAVSTLSRYDPRFNTWLHLASMRQR
RTHFSLAATGGLFAIGGRNVEGLLATTESYLPSANAWQMRAPMEVPRCCHASATLPSGDI
LVSGGYINCAYSRSVA
Download sequence
Identical sequences ENSGMOP00000012824 ENSGMOP00000012824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]