SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013120 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013120
Domain Number 1 Region: 287-571
Classification Level Classification E-value
Superfamily Kelch motif 3.01e-80
Family Kelch motif 0.00000108
Further Details:      
 
Domain Number 2 Region: 16-134
Classification Level Classification E-value
Superfamily POZ domain 6.28e-33
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013120   Gene: ENSGMOG00000012257   Transcript: ENSGMOT00000013469
Sequence length 574
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3610:1161551:1215867:-1 gene:ENSGMOG00000012257 transcript:ENSGMOT00000013469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTSSRMTSNGSEEFFQATNHAELTFRKMETYLQHKQLCDVLLIAGDHRIPAHRLVLSSV
SDYFAAMFTNDVLEAKQEEIKMEGVDPEALRSLVHFAYTGVLELKEETIESLLAAACLLQ
LSQVIQVCCGFLMKQLHPSNCLGIRSFADAQGCLDLLNVAHCYTTEHFLEVIQNQEFLLL
PTAEIVKLLSSDDINVPDEETIFQALMMWVRYDVQSRQQDLGLLLAFIRLPLLPPQLLAD
LENNKMFSDDLECQKLLMEAMKYHLLPERRPMFQSPRTKPRKSTVGALYAVGGMDASKGS
TTIEKYDLRTNTWIQVGNMNGRRLQFGVAVIDNKLYVVGGRDGLKTSNMAECYNPVSKVW
STMPPMSTHRHGLGIAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNYVASMSTPRSTV
GVTALNGKLFAVGGRDGSSCLRSMECFDPHTNKWSMCAPMAKRRGGVGVATYNSFLYAVG
GHDAPASTHCSRLSDCVERYDPKTDVWTTVASLSVPRDAVGVGLLGDRLYAVGGYDGQSY
LGTVESYDAQNNEWAEEVPLNIGRAGACVVVVKL
Download sequence
Identical sequences ENSGMOP00000013120 ENSGMOP00000013120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]