SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013200 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013200
Domain Number 1 Region: 213-341
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.14e-27
Family APC10-like 0.003
Further Details:      
 
Domain Number 2 Region: 1777-1837
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000283
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 3 Region: 1737-1786
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000636
Family ZZ domain 0.018
Further Details:      
 
Domain Number 4 Region: 45-103
Classification Level Classification E-value
Superfamily EF-hand 0.00000036
Family Calmodulin-like 0.057
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013200
Domain Number - Region: 1060-1153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000772
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number - Region: 781-871,996-1044,1498-1745,2031-2077,2257-2270
Classification Level Classification E-value
Superfamily ARM repeat 0.0547
Family PBS lyase HEAT-like repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013200   Gene: ENSGMOG00000012326   Transcript: ENSGMOT00000013551
Sequence length 2837
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4340:1344688:1399445:1 gene:ENSGMOG00000012326 transcript:ENSGMOT00000013551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPGVLLEQVKLREAAARISDSGLAIPESVLAGNEIALMRWLEDRLSRGEESVNVEQFCE
MLEIRNAPRDECEEAFGQFDTEGDGVVDVESMLSALKNSNGANLQGELSHVIRHLQACSL
TPGFVDIFSKYKDELGAHASKILKFLHRNRIPSSAIPFPLLEGYNSICTMRSTLVQNFLE
FLLQKEKDLDIQYRAELIRDPDVDKVKVVTQCFSFIEASSNATDIHRMTDGETGSFWQSD
GSARSHWIRLKMKPDVVLRRLAIAVASNDHSYMPQLVSVAVGKNRRSLQEIRDIRIPSNV
TGYVALLENANITHPYIQINIKRCLSDGCDTRIHGLKTLGYQITKSKEVSVSDASAIWYL
SLLTSLVTASMETNPVLAQTVLQSTQKALRHMPPLSLTPSSTEFPKFFSANILEEVDGFL
LRIADCCVSPEAELTLLAFALARGSVAKVLQALSGISEHLETEYRASSLISSMASVRMRL
LYRNGKPLQLHLQACDVKSKEEKSGPENMLAEPTTGDGFLTESGKKRASIILSTEDQSNF
QVTQMKVKVRKGATGAKCGLVFAYKEANPFDAEKHFDRFKKFDSWDYDDYKDFVQDNVKL
PAQSEDQPIGWFELEEDWNDVEIKLQQCRIAKFLMVKFLCTRQTSAERLGVQSLCFHGYL
VVGAERLGDAEELLPDGGEGPEDLATTGQMLLNKTLFFIQQLTRDMVDVSQFKQKFLLDF
IGLSLTLFWSLYSKLMQIEGEEVMKSRVLLLQLLQNCFPMLPTALEGGGPEEEEEEKEPT
DPPHGAVLELYTHLCQVVDRPETEALVEKALRREAVKALLSGAAIFFPDKHSRRDKLFHM
MKNITEEDQPESVKVTFESLCNYFSDQDPSGLLLLPPKEVSTDFDISPILSVMETLLLVA
TRECEVMMGAVSGGPSRTVLLSLFWALQGSLLSWCYLQLKADTSGMGAQLARDIVVKYVN
QFLGSAQGALASLLERYSGAEITEKLSSSILATVTRQLMIFLLELCSLDIPHSVLLKSFS
SLVELLKNLSSDTGDIFSKVDQESCLQPQQPVVLRTWNMESPHNYENSRHETTIFCCPGA
TSFVVEFDERCQTEKRYDYLEFTDARGGKVRYDTKIGTEKWPKKVTFDAGPQLQFLFHSD
SSNNEWGYKFSVTAQGLPDITVSWMSDVQLLVARLMGRLASRAMALKSPHEIRSVKELPP
GRMAHVQSSPLWKPILRHGACDARDTPQNNTPSVPDEFPRFLEDLARWNPNLEPNEGPAE
PMRTLMLSCRRPPIRNEIAAGSTVDQAVNAIWAAMVYHTPALHQALKAHAPVAQGYKSSL
SEDFVQVYTLADRIRTWMLETKQRHLVSKMNAPDEKEGAQEEVTMEALXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAGPSGLGRVRLLSYRSVEE
PRTVLSVRERYPILKHLLNFMKDQALTTGSVLQTLALNKAQAQSVCRVLESVQQGLLSLG
KPHLFQAPCILFLQELLACQKDFNGYFSQLSGSGQELREEVRRSYHQLVLMLVEAVQGFS
GLNEKALLPALSCVQTCLLHLLDMSWEPQDLPLFLDIKLPDLLLNMSQENISVHDIAISQ
WTEEDEIAVYKKNQEWMDECADGMFEKWYDKIGEEGSVEDRRKMHRFIARYCDLLNVVIS
CDGCERIAPWHRYRCLQCMDMDLCKTCFLSGAKPEGHEDDHEMVNMEYACDHCQGLIVGS
RINCNVCEDFDLCFGCYNAKKYPDSHLPTHRITVFPMVTIRISDRHRLIQPYIHNYSWLL
FAALALYTSALASERRLDGEPLKTGSLDRALALQGRCSQLITECLLKGQDAKGLRSSALL
ALLSSNETSSDSELGPNSPESSRELSTADNTDNSSLPGSTAAVCSPTSPQDTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGLSLPSLSSIL
PQLFRVVVSNAGCLDETYHLTLGLLGQLLLRIPPAEADGAVGEALADKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRIGLDWACSVADILRGLNACPQWSVVIAAFTDHCVQQLP
HTLRRTNLFTLLVLVGFPEVLCMGTQSVFVDNANEQHHMILLKHFTEKNHAAVVDVKTRK
RKTVKDYQLIQPQDSSWAGLPAQAEGQPAHKALISRYLDSFISIISHLLKGSPDPGSPDA
VEASWVLSLALKGLYNTLKKQGVEEAQQAIQRSGLTQLLVRKCSKGTGFSKLWLLRDLEI
LSVMLYSSKREIHSMTQDPERDEREPEPDREQDSDHSSCCTEEPRDPSRPDPLEGLDEET
KICFQITHDALNAPLHILRAMYELQMKRTDSFFLEVQKRFDGDVIKTDETIRTLAQKWQP
SRRPRSERTTKAVDTDMIVVSCVAKPSHCERATEEINLVAQKLITSSEGDLQLSYAKQRR
TKSSALLHKELDARSNRAVRQYLVILQRVLKGCGQSMLCSLSLTACQFMEEPGMAVQIRE
SKHPYDNNTNFEDKVHIPGAIYLSVKFDPRCHSEEGCDELIMSSSADFLQDLHTFSGSPQ
KWSDFEIPGDTLYYKFVADMSNTEWGYKFTVTGGHRGRFQTGFEILKQMLADEAVLSHLP
LSDIWEWQVGVACRQTGTQRLKAIHLLLRLLQCQSQTACELMLLRPLWQLFVSMETTLCQ
DPACITVLLPLHRALTELFFIAESRATAQGILQEYLLAMTTDQQLLNHTAMALKNIAAIS
LAINYPNKSTKLLSMPS
Download sequence
Identical sequences ENSGMOP00000013200 ENSGMOP00000013200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]