SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013591 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013591
Domain Number 1 Region: 202-379
Classification Level Classification E-value
Superfamily MIR domain 1.02e-46
Family MIR domain 0.002
Further Details:      
 
Domain Number 2 Region: 1061-1176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000146
Family SPRY domain 0.034
Further Details:      
 
Domain Number 3 Region: 644-792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000593
Family SPRY domain 0.042
Further Details:      
 
Domain Number 4 Region: 3960-4039
Classification Level Classification E-value
Superfamily EF-hand 0.00000134
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number 5 Region: 1377-1500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000388
Family SPRY domain 0.028
Further Details:      
 
Domain Number 6 Region: 86-168
Classification Level Classification E-value
Superfamily MIR domain 0.00000968
Family MIR domain 0.022
Further Details:      
 
Domain Number 7 Region: 408-533
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000034
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 8 Region: 2099-2165
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000523
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013591   Gene: ENSGMOG00000012679   Transcript: ENSGMOT00000013949
Sequence length 4916
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3217:100473:258974:-1 gene:ENSGMOG00000012679 transcript:ENSGMOT00000013949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDEVVLQCSATLHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICAFVLEQSLSVR
ALQEMLANTEEKAEGTAQGSGHRTLLYGHAVLLRHSYSGMYLCCLSTSRSSTDKLAFDVG
LQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSHGYEHLHVDAAFQ
QTLWSVVPICSGSEVAQGYLIGGDVLRLLHGHMDECLTVASGDHGEEQRRTVNYEGGAVS
IHARSLWRLEMLRVVWSGSHTRWGQPFRLRHVTTGKYLSLLDDRSLLLTDKDKADVKSTA
FCFKSSKEKLDSGMKKEIDGMGVADIKYGDSVCYVQHMDTSLWLTYQAMDTKCARMGGVQ
RKAIMHHEGHMDDGLTLSRSQHEESRTARVIRSTVFLFNRFIRGLDVLSKKGNTSALDLP
IESVSLSLRDLIGYFQPPDEHLEHEEKQNRLRHLKNRQNLFQEEGMTSLLLECIDRLHVY
SSAAHFAEVAGKEAGEAWRSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEAS
SGILEVLHCVLVESPEALNLIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSN
QNLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYRKWYYELIVDQVQPFVTA
EATHVRVGWASTDGYAPYPGGGEGWGCNGAGDDLYSYSFDGLHLWSGCIARTVSSPNQHM
LTVEDVVSCCLDLNSPSISFRINGQPVQGMFENFNCDGLFFPVVSFSAGIKVRFLFGGRH
GEFKFLPPPGYAPCYEAVLPREKLRVEPGQDLAGTRDLLGPTLTLSQAAFTPTPVDTSQI
VLPPHLERIREKLAENIHELWVMNKIQLGWTYGVVRDDNKRQHPCLVEFSKLPEQERSYN
LQMSLETLKTLLALGCHVGLADEHAIEKVHSLKLSPSYELTSSYKPAPLDLSHVKLASAQ
EAMVDKLAENAHNVWARDRIGQGWTYGIQQDVKNRRNPRLVPYALLDERTKKSNKDSLRE
AVRTLLGYGYNLEAPDQDHAARADLDNVSAERFRVFRAEKTYSVSAGKWYFELEAGEIRV
GWARPGCLPDQELGSDEQAFAFDGFKAQRWHQGNEHFGRSWQPADVVGCMVDLGERTMMF
TLNGEVLLDDSGSELAFKDFEVYEGFIPVCSLGVCQVGRMNFGKDVSTLKYFTICGLQEG
YEPFAVNMNRDITMWLGKRLAQFIPVPHNHEHVEVSRIDGTMESYPCLKVTQKSFGSQNS
STDITFYRLSMPIECAETFSASLGGGAPAYVFPPKKECEDFETVADFEVLVKSSHGHMGP
QDEFNNHKDHNQEKPSKFKQRLMLKRAKPDNSPSARLSEEVTVAGDMDDCEFPMQTSTYF
FSVRVFPGQEPGSVWVGWVTSDFHQYDPSFELHKVRTVTVTLGDEKGKVHESIKRSNCYM
VWAGECTSPGQGRSNNNGLEIGCLVDTASGLLTFTANGKELSTYYQVEPSTKLFPAVFAQ
ATSPNVFQFELGHIKNVMPVSAGLFKSEKMNPAPQCPPRLHVQFLTSVLWSRLPNHFPKV
SVSRVNDRHGWLVQCNEPLQFMALHIPEENRSMDIQELSEHAELLKFHYHTLRLYSAVCA
LGNNRVAHALCSHVDEAQLLQAIENKYMPGLLRTGYYDLLMDIHLSSYATARLMMNNEYI
VPMTEETKTITLFPDHTKKHALPGIGLSTSLRPRMHFSSPSFVSWDCFQHSPEFPLETLK
TKTIGMLTEAVREGSMHVRDPVGGSSEFLFVPLIKLFYTLLIMGVFHNGDLKNVLQLIEP
NVFSEGRRGPQASATGLTEQEEGGGGGGGRGLLQMKLPEPVKLQMCRLLQYLCDCQVRHR
IEAVVAFSDDFVACLQANQKFRYNEVMQALNMSAALTAKKTKEFRSPPQEQINMLLNFKD
EKHECPCPEGIREQLMAFHEDLMIHCGIEIDEDKGNDCDGDCTFRGRLMSLVEKVANLKR
KTDELPKKKKDKKPSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGQVRA
LPKTYTINAVSVEDTIKLLAALGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNL
MRALGMHETVMEVMVNVLSGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYL
LENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVQYLAGCGLQSCAMLV
SKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGN
GLLAAMEEAIHISANACRDRPSSPASESTKSLEDEEDDTIHMGNAVMTFYAALIDLLGRC
APEMHLIHAGKGEAVRIRAILRSLIPIQDLEGVISIPFSMPTLATDGSVVEPDMSAGFCP
DHKAAMVLFLDRVYGIEDQNFLLHLLEVGFLPDLRAAASLDTAVLSATDMALALNRYLCA
AVLPLLTKCAPLFAGTEPYASLIDSLLHTVYRLSKGCCLTKAQRDAIEDCLLAVCGKLRP
SMMQHLLRRLVFDVPLLNEHTKMPLKLLTNHYERCWKYYCLAVGWGGFGVASDEELHLSR
KLFWGIFDALSRKVRYDQELFKLALPCLSAVAGALPPDYMESNYVAMIEKQSSMDSEGNF
NPQPADTSNVSVPEKLDYFINRYAEHLHEKWSMDKFSEGWLYGEQLCEATKSQPLLKPYK
GLSEKDKESYRWPIKESIGTMVSWGWVVERIREGDPSSLQKSRRISQVSQLSFEGAPGFS
PRPIDMSNVTLSRDLHXXXXXXXXXXXXXXXXXKKKKMEMEAKGGGSHPLLVPYDTLTAK
EKSRDREKAQEIFKFLQINGYTVSRCVREQDLDTPAIEKRFAYTFLQQLIEYVDKAHQHM
MDADAGTRAKGEESPQEQQTKFFGKVLLPLVDQYFKNHRLYFLSTAIRPISSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKAALRAF
FENAAEDLEKTQDNLKLGQFTHERTQPRDVTQVINYTTFALLPVLSSLFEHIGQNLFGQD
LILDNVQVSCYRILNSLYSLGTSKSIYVERHRPAIGECLAAFSAAFPVAFLEPYLDMFNG
FSIYNSKGAKERGALGLPAPVLEACPLIPSLEKTLEEIMTLAESGIRYTQMPHIMEVVLP
MLCSYMSHWWEYGPENNPESTDRCCTSLRWEHMNALLGNILKIIYNNLGIDEGTWMKRLA
VFSQPIISKANAQLLKTHFLPLMEKLKKKAAVVLMDEEQTKAEGRGDMSEAELLVLDEFT
ILVRDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIFWAKSHNFKREEQNFV
VQNEINNMSFLITDTKSKMSKGAISDQERKKLKRKGDRYTMQTSLIVATLKRMLPVGLNI
CAPGDQELIALAKNRFTQKDTEDEVREIIKSNLHLQGKLEDPAIRWQMALYRDLPNRNEE
TSDPEKTVERVLDIAHVLFHLDQVXXXXXXXXXXXXXXXVEHPQRSKKAVWHKLLSKQRK
RAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIEAEDHYFEDKLIEDLAKSGEDEPAEEE
DSLKHIDPLHQLIQLFSRTALTEKCKLDEDNLYMAYADIMAKSCHDEVEEDGDEVKSFEE
KEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVASTLKLGIAVLNGGNSTVQQK
MLDYLRDKKDVGFFQGLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVMQDDEFT
CDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKE
VIDEQGQRNFSKAINVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQM
KLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKF
FDMFLKLKDLTSSDAFKEYDLDGKGKAPDRSVISKRDFHKAMESHKHYTQSETEFLLSCA
ETDENELLDYEEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLALAESVLDYFQ
PYLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFV
NFCEDTIFEMQLAAQMSDAGERSAVKEESEQERPEEAGPETGFFSVATLRTALLALRYNV
VIVMKVLSMKSVKKQVKRLKKMTVRDLVTTLASFYWSTLLRVLYVVFSVARGFCRITYKS
LMGGSLLNGGSAMKVSELLGSLPDLSQDEGVRGEGAEPEKKSSDRAFHPEDELADLAINT
GETEVLSDIFGLDLRREGGQYKLTPHDPNASLTHLLISPPAIPSPELRQRHQIKSSGLED
SEGTAETSHESKKTGPENEDKDKVKKEAMAKQKIRQNYIFKSEEPDLQESVFWKKIIAYQ
RKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSAVVEQKELLYPSSQSRVDREAP
RPVTVHFVLEESSGYMEPTLRILAIMHTVISFFCIIGYYCLKVVPLVIFKREKEVARKLE
FDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGHDRISELLG
MDRAALDFSDSHEKRKPKKDNSLAAVLNSIDVKYQIWKLGVVFTDNSFLYLAWYMTMSIL
GHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRK
FYNKGEDGESPDMKCXXXXXCYMFHMYVGVRAGGGIGDQIEDPAGDEYEIYRIIFDITFF
FFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQ
EHNLANYLFFVMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSGMOP00000013591 ENSGMOP00000013591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]