SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013613 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013613
Domain Number 1 Region: 160-296
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-24
Family Kelch motif 0.0055
Further Details:      
 
Domain Number 2 Region: 344-473
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-17
Family Kelch motif 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013613   Gene: ENSGMOG00000012726   Transcript: ENSGMOT00000013971
Sequence length 478
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1188:51989:53713:-1 gene:ENSGMOG00000012726 transcript:ENSGMOT00000013971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERFIADGLTAATCCGYANLAEGHALGYALADANYTIATEMRTLLRHHRQELLELNGQSLT
AALEAEEIPGVEEAELVALALDWLDANGPLPLLKSNLLLSRLRFGLVPSCDLMRLSGSHK
ALATPLVRSQLTKALEYHRLGSAQPIRQTRQSSLRASPNRVLLVGGGESPDWPGQQILTF
DLRDSTFSPLKSRLPRRLRNHCVCSVGGFLFVIGGDLVSEGDDGGGGKSVATTTSNEVWR
YDPRFDEWEKAASMLERRSWFCCCVVADVIYAIGGRQTRPGAPTHTALSSVECYNXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGNRGDHGECSRELLRWEPGAGGKTW
EPRASMSIARFGHRMAALGDHLYALLGMHEPFCDIERYDWPSDHWTRLRPLTIGASCYGM
AKTPSGTLLLFGGRKWSEGQEVTVRSVLEYDVLRDRWKDVCLLPEPLTGTECTLLPLP
Download sequence
Identical sequences ENSGMOP00000013613 ENSGMOP00000013613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]