SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013945 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013945
Domain Number 1 Region: 128-354
Classification Level Classification E-value
Superfamily Kelch motif 1.11e-49
Family Kelch motif 0.0041
Further Details:      
 
Domain Number 2 Region: 581-664,699-729
Classification Level Classification E-value
Superfamily POZ domain 2.36e-19
Family BTB/POZ domain 0.0095
Further Details:      
 
Domain Number 3 Region: 354-403,436-503
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000667
Family BTB/POZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013945   Gene: ENSGMOG00000013033   Transcript: ENSGMOT00000014308
Sequence length 771
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4644:56494:67814:1 gene:ENSGMOG00000013033 transcript:ENSGMOT00000014308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKVAPSVDFDHSCSDSVEYLTLNFGPFEPVRRWRRLPPCDEFVGARRSKHTVVAYRDAIY
VFGGDNGKNMLNDLLRFDVKDCSWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIY
SNSNLKNKNDLFEYKFATGQWTEWKVEGSLPVARSAHGATVYDDKLWIFAGYDGNARLND
MWTISLQDREQGCWEEMDQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFK
GHMWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGVADNTLPNELHCYDVDSQSW
EVIHPSLDLRPQMPSGRLFHAAAVIHDAMYIFGGTVDNNVRSGEMYRFQFSCYPKCTLHE
DYGKLWENRQFCDVEFILGEREERVLGHIAIVTARCQWLRRKILQARDRQRQKAKQESGE
EAEEGSAGPWEVPAALGPNLEVSIREAEPQPFRVLMQFLYTDKIQYPRRGHVQDVLLIMD
VYKLALSFQLARLEQLCVQYIEASVDLQNVLSVCENANKLQLDQLKEHCLNFVVKESHFN
QVIMTKEFERLSTQLIVEIVRRKQQPPLRLYSDQPVDIGTSLVQDMKAYLEGGGLDFCDI
VLLLDGHPRPAHQVILAARSSYFEAMFRSFMPVDGQVNISIGEMVPSKQAFESMLRYIYY
GDVNMPPEDSLYLFSAPYYYGFSNNRLQAYCKQNLEMNVTVENVLQILEAADKTQALDMK
KHCLHIIVHQFIKVSKLPNLRSLSQLLLLDIIESLATHISDKQCAEMGPDI
Download sequence
Identical sequences ENSGMOP00000013945 ENSGMOP00000013945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]