SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014109 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014109
Domain Number 1 Region: 9-361
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.23e-135
Family Calpain large subunit, catalytic domain (domain II) 0.0000000026
Further Details:      
 
Domain Number 2 Region: 364-519
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.92e-57
Family Calpain large subunit, middle domain (domain III) 0.00000148
Further Details:      
 
Domain Number 3 Region: 534-711
Classification Level Classification E-value
Superfamily EF-hand 2.02e-48
Family Penta-EF-hand proteins 0.00000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014109   Gene: ENSGMOG00000013176   Transcript: ENSGMOT00000014473
Sequence length 713
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2356:186138:203668:-1 gene:ENSGMOG00000013176 transcript:ENSGMOT00000014473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYTPSGFFCDRLIRERERRDGEGSLGKPLRFSGQDFTALKQECLQKKSLFEDDTFPATV
ESLGYKELGAKSNKVKNIVWKRPKEICENPEFIVGGASRTDICQGDLGDCWLLAAIACLT
LYEKLLYRVVPQEQSFSEGYAGVFHFQFWRYGDWVDVVIDDRIPTFNNQLVFTKSAERNE
FWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEMKEAPKELNKIMKKALERG
SLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVQECKPPRKDSKVRLVRLRNPWGQVEW
TGPWSDNSKEWTSLSKDEKEKLQHQNAEDGEFWMSFEDFKKNFTKIEICNLTPDALEDDK
IHKWTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPEDNEVACSFVVSLM
QKNRRKERKMGANLFTIGFAIYEVPKEMHGNKQHMQKDFFLANSSKARCKSYINLREVTQ
RFRLSPGEYVIVPSTYEPHQEGEFLLRVFSEKRNTSEEIENRIEADHPVPAPASAVGEES
EEDQKFRTIFQEIAGDEMEITANELKNLLNKVVSKNQELNTEGFSLETCRSMIALMDMDG
TGRLNLQEFRHLWNKVKQWQGIFKHYSVEQSGSISSYEMRNAVNDAGYRLNNQLYDIITM
RYANESMNIDFDSFISCLVRLEAMFRAFQAFDQDGDGSIRLSALEWLQLTMYA
Download sequence
Identical sequences ENSGMOP00000014109 ENSGMOP00000014109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]