SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014471 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014471
Domain Number 1 Region: 242-555
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-38
Family Kelch motif 0.0098
Further Details:      
 
Domain Number 2 Region: 6-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.12e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014471   Gene: ENSGMOG00000013527   Transcript: ENSGMOT00000014845
Sequence length 729
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2279:304:35915:-1 gene:ENSGMOG00000013527 transcript:ENSGMOT00000014845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVPENRVLSFGVFKWSSYSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPA
IVQSITFGKYEKTHVCNLKKFKVFGGMSEENMTELLSSGLKNDYNKETFTLKHKIEEQMF
PCRFVKIVPLMSWGPSFNFSIWYIELHGIEDPDVVQPCLNWYSKYREQEAIRLCLKHFRQ
HNYTEAFESLQKKTRVALEHPMLSHLHDRLVLCGDFDSCEELIDKAVGDGLFNQYISQQE
YKPRWSQILPKCHKGDADDNRPGMRGGHQMVIDVQSETVYLFGGWDGTQDLADFWAYSVQ
ENQWTCISRDTEKESGPSARSCHKMCMDSQRRQIYTLGRYLDSSVRNSKSLKSDFYRYDI
DGNAWTLLSEDTSADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSMEDSRASEPQFS
GLFAYHCLAGTWSLLRDDSCNAGPEDVQSRIGHCMLFHTRNRCLYVFGGQRSKTYLNDFF
SYDVDADHVEIISDGTKKDSGMVPMTGFTQRATIDPDLNEIHVLSGLSKDKDKREENVRN
SFWIYDIARNNWSCVYKNDQAVKENSNKSLQEEEPCPRFAHQLVYDEMHKVHYLFGGNPG
KSCSPKMRLDDFWSLKLCRPTKEYLLRHCRYLIRKYRFEEKAQAEPLSALKYLQNHLSLT
VDHADPEEIKEFQMLPSALFKSSSDFIPLXXXXXDQTYAQRTQLFDTPVSFFPDNMTPPK
GNLVDLITL
Download sequence
Identical sequences ENSGMOP00000014471 ENSGMOP00000014471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]