SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014732 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014732
Domain Number 1 Region: 498-606
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-29
Family SH2 domain 0.00000358
Further Details:      
 
Domain Number 2 Region: 181-270
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-25
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 301-414
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000931
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014732   Gene: ENSGMOG00000013772   Transcript: ENSGMOT00000015112
Sequence length 610
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3531:3177:27894:-1 gene:ENSGMOG00000013772 transcript:ENSGMOT00000015112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDYFLPHPNYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDVDLEQLVNE
MNASAESVHAAAAACADTVPLLHNGLPPPHHPHPQQQQPRPRPSLQQHVPGGHSHAQRPL
PQSSSRGALPHSLPMQIQAVRRLQGEHQVRPSSLPAIPNPFPELCSPSGSPILSPIQISD
NHIVKVWSEDGAGKVLEILAEMTARDVCQLLVYKSHCLDDNCWTLVEHYPLLGLERCVED
HELVVQVQLSMGSEGKFLFRKNFAKYEFFRNPLNFFPEQMVAWCQESNGSIPPSQLLQNF
LDSSSCPEIQGHLYLRETGRRSWKKLYMFLRRSGLYYSTKGTSKEPRHLQLLADLEDNNM
FTAVTARKAHNAPTDYQFSIKPSKARSECKELKMLCAEDEQSRTCWTTAFRLLKXXXXXX
XXXXXXXXXXXXXXXXXXXXRSVSENSLVAMDFSGRTGRVIDNPAEAQSAAMEEGQSWRK
RSQRLNVLGSPGPLHTPSLSAVIHRTQLWFHGRIVREEAQRMMVQQGQVDGLFLLRDSQS
NPKAFVLTLCHHQKTKHFQILPYEEEGQVFFSLDDGATKFTDLIHLVDFYELNRGVLPCR
LKHPCTAVAL
Download sequence
Identical sequences ENSGMOP00000014732 ENSGMOP00000014732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]