SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014828 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014828
Domain Number 1 Region: 51-200
Classification Level Classification E-value
Superfamily EF-hand 1.66e-34
Family Calmodulin-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014828   Gene: ENSGMOG00000013884   Transcript: ENSGMOT00000015210
Sequence length 202
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4155:75677:81967:-1 gene:ENSGMOG00000013884 transcript:ENSGMOT00000015210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAAERTPSTTSGSSSEPPKKSKKKTKKKTTEAMTVVYTSVLNSVFGAERELAQAELDE
LADAFKEFDYDQDGYLNYKDVAECMRTMGYMPTEMELLEIVQQIKMRMGGLMDFEDFTEL
MGPRMMGETADMLGLKELQSAFVQFDLDGDGKINQEEMKEAVKTLLGEKLKKGELEEILK
ELDINADGDIDFEEFVMMLSIR
Download sequence
Identical sequences ENSGMOP00000014828 ENSGMOP00000014828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]