SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015362 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015362
Domain Number 1 Region: 190-274
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Domain Number 2 Region: 61-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000258
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015362   Gene: ENSGMOG00000014364   Transcript: ENSGMOT00000015755
Sequence length 496
Comment pep:known genescaffold:gadMor1:GeneScaffold_3186:3137:9675:1 gene:ENSGMOG00000014364 transcript:ENSGMOT00000015755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMAAKINAMLMAKGKLLTPPPLLAKTPISVSVPTSIEETVVTEVDINDVPINCRDLL
TKGKTQEEIRLISGAVVSTKGRYMSDAFRGKGAERPLYLHVQGKNQEQVNKAVLRIKEII
SEDVLRSALSGGRQVPVFPPLTLYPQPPRAAGPPAMPRLSNPASAQGHRPAAPHSGSFVH
TKIFVGLDQALPSFNVNDKVEGPGGTYLGHIQTETGARVFLRGKTSGYIEQASKRESFEP
LYVYISHPNSTGLEAAKKLTESLLETVRAEHSCMVSNYTATGSTQPYAAQGFPPNSNYSS
QGSWYSYPANGYAGGYTAYPGAAGYWSNSNGPPSHSNLSTNPQSSQAMVQYPVCPRKPHP
YLVQDRVSSDIREPEGFTGSPPTPGSPKRHFQEGARLPTGGPADAPAHLEPPPPASNDGE
EMGAERVLMPPPPPLFAAPLPIARKRPREVPPPRSAAPPGVAEQCVKKCRVVEDSSGLVP
YGGDSSDEEEERTHSS
Download sequence
Identical sequences ENSGMOP00000015362 ENSGMOP00000015362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]