SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015521 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015521
Domain Number 1 Region: 110-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-27
Family Second domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 236-349
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-21
Family Third domain of FERM 0.0079
Further Details:      
 
Domain Number 3 Region: 15-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.37e-17
Family First domain of FERM 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015521   Gene: ENSGMOG00000014492   Transcript: ENSGMOT00000015917
Sequence length 612
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3468:35020:55940:1 gene:ENSGMOG00000014492 transcript:ENSGMOT00000015917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLPFHNNRAMQDRRCVCVFLPNDDTLNVIVNVKTLSQELLVQVCDLLRLKDCHLFGLS
VVQNNEHIYMELDQKLSKYCPKEWKREASKGIDQFGPPMIIHFRAQYYVENGRLISDRAA
RYYYYWHLRKQVLLSQCVQREEAYFLLAAFALQADLGNFKRNKHFGKYFEPEAYFPPWVI
TKRGRDYILRHIPNMHKDQFALTASEAHLKYIKESAQLDDVTVXXXXXXXDKKEVEASLT
LGLTLRGIQIFQNVGSVRQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLMYYTGCPV
RSRHLLQLLSNSHRLYMNLQPVLKQVRHLEENEEKKQYRESYISSSDALELDMDPLDKRC
RASGSSAGSMSHHHKRLSRHSTASHGSSHTSGVETDSFRTPGQPPHRALRGCSSSTTSQG
SSHTSGVESSGKDRILDEGKIEMLVDDPKDYEELHEMALELTQDLCIHITEDMLTLSPDQ
GSGYSGLIVKDVSSSTSSSSETVVKMRGQSIESLPQTLVCRKTQSSTDRHSQSLDDVRLY
QKGCMQWAELCQDTAHSYTFGCAQELSDSCAYPGLTEPSVGVRGEQHAFPIKRTNKYFSL
DLTSDEVPEFVV
Download sequence
Identical sequences ENSGMOP00000015521 ENSGMOP00000015521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]