SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015888 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015888
Domain Number 1 Region: 319-597
Classification Level Classification E-value
Superfamily Kelch motif 7.59e-84
Family Kelch motif 0.00000053
Further Details:      
 
Domain Number 2 Region: 46-164
Classification Level Classification E-value
Superfamily POZ domain 1.18e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015888   Gene: ENSGMOG00000014816   Transcript: ENSGMOT00000016292
Sequence length 610
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3166:65818:78597:1 gene:ENSGMOG00000014816 transcript:ENSGMOT00000016292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMDAKPMRRATSARQDATGMDITSRCTLGDPNKLPEGVPQPARMPYVSDKHPRQTLEVIN
LLRKHRELCDVVLVVGSKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAM
ELLIDFAYTSQVTVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADT
HSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWV
KYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQE
RPLMQGPRTRPRKPIRCGEVLFAXGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVG
VSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVG
GQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVER
YNPQENRWHTVSPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVA
MTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGVGVI
KMTHCESHIW
Download sequence
Identical sequences ENSGMOP00000015888 ENSGMOP00000015888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]