SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016132 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016132
Domain Number 1 Region: 608-887
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000105
Further Details:      
 
Domain Number 2 Region: 93-196
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-29
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 3 Region: 194-307
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-25
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 4 Region: 486-583
Classification Level Classification E-value
Superfamily PDZ domain-like 5.59e-19
Family PDZ domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016132
Domain Number - Region: 60-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000227
Family First domain of FERM 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016132   Gene: ENSGMOG00000015017   Transcript: ENSGMOT00000016543
Sequence length 896
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4378:521130:547773:-1 gene:ENSGMOG00000015017 transcript:ENSGMOT00000016543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMPKPDLLCLVQLLNGTIHTFRVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XRWLEPEKPLKKQMKGLVAPFYLNFRVRFFISDPNSLQHEQTRHLYFLQISSDIREGRLQ
CPLSAAVVLASYAVQSELGDHSQSCLPGYLSKSHFLPEQDDDFLSKVEDLHPQHKGLKQS
EAELCFLNTARTLELYGVELHAAMDSTSVPLLVGLASSGVAVFCNMICSSFFPWGNIIKI
SFKRKRFLVHLKRKHGETQDCEVSLVLGCPKACKNLWRSSVDHHSFFSSSRSSRSPKHNY
TAQAYSKLITQHLGRLGPTDXXXXXXXXXXXGPVCQRVVGGMVWNPVLQRSLSSEYLETK
SLPSRSPPNTPNWRSPRVRHGVSKPRPSSVELTNELEDMTEGEDVFYTYRVSVGSSRGSE
GGESPQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPPLGDGDLLLVRIAPDHEGRFGFNVKGGVDQKMPLAISHVKPESPAGRCEPQLLEGDL
LVLINGRDISEHTHDQVVMFIKASRESHSRELALLIRRSGRVAQLLQFPPSLSLTGQSES
DKPSSPGQAERASTLEDSMRQLERGLQSGTLSFHFENLYRRKPGLLLGCSRLPENMEKNR
YKDVLPYDVSRVVLQDQEDYINASHITSAPPSSGMCLRYIAAQGPLPHTCTHFWQCVWEQ
QTHTIIMLTTLTERGRTKCHQYWPHPAEVKEYGCLRVSCHSEECTLAYVTRCFTLTHTQR
GERAVTHLQYVAWPDHGVPDDPSDFLQFVNCVRDRRKGQETLMVHCSAGIGRTGVLITME
TALALLEEGRPLYPLDVVRALRDQRAMMVQTTCQFQFVCEAILRVYKVSTQLSFPP
Download sequence
Identical sequences ENSGMOP00000016132 ENSGMOP00000016132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]