SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016545 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016545
Domain Number 1 Region: 284-570
Classification Level Classification E-value
Superfamily Kelch motif 1.05e-62
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 1.7e-30
Family BTB/POZ domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016545
Domain Number - Region: 148-187
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0149
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016545   Gene: ENSGMOG00000015458   Transcript: ENSGMOT00000016963
Sequence length 583
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1605:4860:7263:1 gene:ENSGMOG00000015458 transcript:ENSGMOT00000016963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTWCDVFPFKDFELSSYLLAQLNLLRQERILTDVLLCTEHWEIPCHRSILVSSSPYFR
AMFCSNFLESSQSRVDLKGISPDVLAGIVDYVYTGCITITMDIVLPLMQAASMLHYGRLV
EACSLFLQRQLSPDNCLSMIRLSDILHCESLRDRAKEMAVRCFSDVAATEDFCELSLPEL
MCYLEDDRLCAEEEQVFETLLAWIHHDPFSRRGAIHDLFKKVRLRYIHPTYLFQFIANDP
LVQSSTLCTEIIESVRRLMLSVSTRCSRELKPLWTTPRRYTCRETLVVVGGRKNNEQTSR
EALLYDERTQRWQWLAKLPLRLYKAAYVCIHSILYVVGGLSLCMASGDSSVSATVYTLSL
KTNQWRTAEPMLQPRYAHQGVSYLHFIFVLGGIGVDKQICDSLERYNSMFNQWEAMAPMP
TAVLHPAVAASDQKIFVFGGEDAMQNPVRLIQVYHISRNLWSSLETRTVKNVCAPAAVIE
DKIYIVGGYTRRMIAYDTKANKFVKCENLKERRMHHSATVINNKLYVTGGRFLNSQDVIE
DSDCFEIYDPKADVWASKGSLPYKLFDHGSLPLVCVSNRPNPP
Download sequence
Identical sequences ENSGMOP00000016545 ENSGMOP00000016545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]