SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016815 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016815
Domain Number 1 Region: 199-347
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.43e-30
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 2 Region: 21-119
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000057
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 3 Region: 614-647
Classification Level Classification E-value
Superfamily SPOC domain-like 0.00000129
Family SPOC domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016815   Gene: ENSGMOG00000015679   Transcript: ENSGMOT00000017234
Sequence length 650
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_364:7:2409:-1 gene:ENSGMOG00000015679 transcript:ENSGMOT00000017234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGARCGAGAAPQTARSPRAPGTLEYKTLLISNLGSQVSDEDVEDSLFHEFKKFGDVSVKL
SHTPELGRVAYVNFRHPEDAKEARHAKSTRLVLGDRQLKVEPMYVRRRSVTPPEVGYLPL
HAPYPYRQRSMSPPGPALAGIRDPRARHYALESLGLGRERERILDYYGMLEERRQPYGFP
PVPVVPEELKPEDDQRATSNLFIGNLDHNVTEVELRRAFDKYGIIEEVVIKRPARGQGGA
YGFVKFQNLDMAHRAKVAMQGRVIGVNPVKIGYGKATSTTRLWVGGLGPGISLTALAREF
DRFGSIRNIDYVKGESFAYIQYESLDAAQAACTQMRGFPLGGPERRLRVDFAKVEESPPR
VFPSGYQPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQRLRMDQTRLDEVARRIKQGRPDGYAILLALQGPVD
Download sequence
Identical sequences ENSGMOP00000016815 ENSGMOP00000016815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]