SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017222 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017222
Domain Number 1 Region: 440-674
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-34
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 810-964,1004-1082
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-33
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 1128-1211,1249-1401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.79e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 61-231,280-350
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-32
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017222
Domain Number - Region: 1408-1553
Classification Level Classification E-value
Superfamily EF-hand 0.000515
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017222   Gene: ENSGMOG00000016019   Transcript: ENSGMOT00000017651
Sequence length 1616
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4550:21669:135713:-1 gene:ENSGMOG00000016019 transcript:ENSGMOT00000017651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMADPPLSSYIMDEETLKRKQKEKLKKLMATGGNPRPLRSLFFLSLKNPIRRASINIVEW
KPFEIIILLAIFANCVALAVYLPMPEEDSNNTNSNLESLEYIFLLIFSVECFLKIVAYGF
LFHADAYLRNCWNILDFVCVSVGLFSVAMDAINHLSGVEAQVGEKGGGFDMKALRAFRVL
RPLRLVSGVPSLQVVMNSIMKSMLPLFHITLLVFFMVTIYSIMGLELFKCKMHKTCYYTG
TIIATVENEKASPCAQAGNGRRCTINGTECRAGWPGPNNGITHFDNLGFSMLTVYQCITT
QGWTDVLYWVNDAIGMEWSWIYFTTLILVGSYFVLNLVLGVLSGEFTKEREKAKSRGEFQ
ILRETQQLDEDLKGYMEWITQAEVIDNDQEGQGLLPLEDGGSEADSFSKMDTMHRIIFYY
KRARRWNHFCRRKCRMYVKSKLFTWWVILLVFLNTLAVATEHHQQSKSLTDWQGTSNKLL
LSMFAIEMLMKMYALGLPSYFMSLFNRFDCFVVTTGILELILVRMNIMSAMGISVLRCIR
LLRLLKVTKYWTTLSNLVASLLNSMRSIACLLLLLFLFIVIFSLLGMQVFGGKFNFSNQP
KPRSTFDSFPQALISVFQILTGEDWNLIMYDGIMAYGGPSMPGILVSIYFIILFICGNFI
LLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKKALANMPDKAAEEKAFLAKKLADQRAK
GIEGIPTTAKLKIDEFESNVNEIKDPFPPADFPGDDEEEDPDIPESPRPRPMADLQLKEE
AVPMPEASSFFIFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRN
QVLAYADIVFTSVFTAEIVLKMTTYGAILHQGSFCRNSFNILDLLVVSVSLLSMGMESSA
ISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQL
FKGKFYSCTDPDQLTELTCKGWYVRYEEGALHEMEIRKRNWVNSELNFDNILNGMLALFT
ISTFEGWPKILYKAIDSNLEDTGPVYNNRVAISIFFIIYIILIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSCYFEYLMFLLIM
LNTMCLGTQHCNQSEHVTHLSDMLNVIFTVLFTVEMILKLMAFKAKGYFGDPWNVFDFVI
VIGSVVDVTLSEVDAALASSGGLYCLHGCMEVDPMQAIAKSKENMSVSITFFRLFRVMRL
VKLLNRSEGIRNLLWTFIKSFQALPYVALLILMLFFIYAVVGMQIFGKIALVDGTYINRN
NNFQTFPQAVLLLFRCATGEAWHEVMLACMYGKRCDPKSDYLPGEENTCGANFAIIYFMS
FYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPQHLDEFKKIWAEYDPEATGRIKHLDVV
TLLRRIPPPLGFGKFCPHRIACKRLVSMNMPLNSDGTVTFNATLFALVRTALKIKTEGNF
EQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQDYFRKMKKRQEEY
YGFRPDKTKASNEIQAGLRNIEEEAAPELTRTISGLLLNEEELNETDEGAIFRVSW
Download sequence
Identical sequences ENSGMOP00000017222 ENSGMOP00000017222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]