SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017294 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017294
Domain Number 1 Region: 90-180
Classification Level Classification E-value
Superfamily WWE domain 4.45e-29
Family WWE domain 0.00089
Further Details:      
 
Domain Number 2 Region: 19-102
Classification Level Classification E-value
Superfamily WWE domain 5.49e-25
Family WWE domain 0.001
Further Details:      
 
Domain Number 3 Region: 386-489
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-20
Family RING finger domain, C3HC4 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017294   Gene: ENSGMOG00000016117   Transcript: ENSGMOT00000017723
Sequence length 614
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2075:212721:282669:-1 gene:ENSGMOG00000016117 transcript:ENSGMOT00000017723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPGSGVSGLGYPPQNLARVVVWEWLNEHGRWRPYSAAVCHHVENVLKGDARGTVVLGQ
VDGQLTPYVIDLQSMHQFRQDTGTMRPVQRNFYEPSSAPGKGVVWEWENDSGSWTPYDME
ICVTIQNAYEKQHPWLDLTSLGFGYLIDFGSMVQTNRQSQRTRRLRRRMDLAHPLIMGSI
PKSQSWPVGASSGQPCSCQQCILVNSTRVASNAILASQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHGHHALTVNGQNNLNRPGTQRASVGAA
RGAIPPGVPALPVKNLTGSGPVHPALAGMTGILLCAAGLPVCLTRAPKPVLHPPPINKGD
MRPVPGVNGTRRKTKKKHLRRASGKNPEDVVRRYTEKIKVVPDEDCTICMERLVMSSGYE
GVLNQKGIKPELVGKLGKCGHMYHLLCLVAMYNNGNKDGSLQCPTCKAIYGEKTGTQPPG
KMEYHLIPHCLPGYLDTKTIRIVYDIPAGIQTPEHPNPGKKFSARGFPRHCYLPDNDKGR
KVLKLLIMAWDRRLIFTIGTSSTTGEGDTVVWNEIHHKTEFGTNLTGHGYPDPKYLDNVL
TELSAQGVGRDDLP
Download sequence
Identical sequences ENSGMOP00000017294 ENSGMOP00000017294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]