SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017386 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017386
Domain Number 1 Region: 203-380
Classification Level Classification E-value
Superfamily MIR domain 4.97e-45
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1064-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000311
Family SPRY domain 0.069
Further Details:      
 
Domain Number 3 Region: 3893-3954
Classification Level Classification E-value
Superfamily EF-hand 0.0000000111
Family Calmodulin-like 0.024
Further Details:      
 
Domain Number 4 Region: 643-791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000158
Family SPRY domain 0.043
Further Details:      
 
Domain Number 5 Region: 419-532
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000248
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 6 Region: 1309-1429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000427
Family SPRY domain 0.021
Further Details:      
 
Domain Number 7 Region: 2040-2104
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000523
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017386   Gene: ENSGMOG00000016054   Transcript: ENSGMOT00000017816
Sequence length 4814
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1265:160874:297001:-1 gene:ENSGMOG00000016054 transcript:ENSGMOT00000017816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDDEVVLQCVACIQKENRKFCLTAEGLGNRLCYLEPTSEAKYVPPDLCIASFVLEQSLSV
RALQEMLAKSGQNSEAAAQGGGHRTLLYGHAILLRHSFSAMYLTCLKTSRSQTDKLSFDV
GLQEDSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLSISNGSIQVDASF
MQTLWNVHPTCSGSNKVEGYLLGGHVLRLFHGHDEVLTIPGSDQTEEHQRIVNYETGKAG
AKARSLWRLEPLRISWSGSHIRWGQAFRLRHLTRGHYLALTEDRGLVLQDREKADTTSTA
FCFRSSKEKLEHSPKRDMDGMGLAEIKYGDSLCFVMHMATGLWLSYQAVDVKSARLGPLK
RRACLHTEGHMDDGLTLQRCQHEESRAARIIRNTTRLFSRFIRDLDCLGAKNRALVALPI
EEVLQTLNDLITYFQLPDAELEHEEKQIKLRSLKNRQNLFKQEGMLTLVSNCIDRLNVYN
SAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNNLDWLVSKLERLESSS
GILEVLHCILIESPEALNIIQRTHIKSIISLLYKHGRNHKILDVLCSLCVCNGVAVRTNQ
NLICDHLLPKRDLLLQTRLVNDVQSMRPNIFLGVSEGSAQYKKWYYELMIDQVDHFVTSE
PSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSAGRVQRAVASLNQHV
LTTEDVVSCCLDLAAPSVSYRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGGRH
GEFKFLPPSSYAACFEALLPKEKMKVEPVKEYKRDAEGVRDLLGTAQFLSQASFIPTPVE
TSQIIMPPHLEKVRDKLAENIHELWGMNKIELGWSYGKIREDNKRQHPCLVDFSKLPDTE
KNYNLQMSSETLKTLLALGCHVLLVRPGAEDSLKKIKLPKNYMMSNGYKPTPLDLSDIKL
TPGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDVKSKRNPRLVPYALLDERTKKSNRD
SLREAIRTLIGYGYNIEPSDQEGAGHVVERLTIDKIRFFRVERTYAVRTGKWYFEFEAVT
GGDMRVGWARPDCKPDLELGTDELAFVFDGYRGHRLNMGSRFFGRSWRAGDVVGCMINME
DKSMVFTLNGEILITNKGSELCFADFETEDGFIPVCSLGLAQVGRINLGKEASSFRYYTM
CGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPKDHNHLMITRIDGTVDSPPCLKVTHKT
FGTQNSNADMVFCRLSMPVELHSLFKTSAVADMNGVHEEESLKXXXYYHSVRVFAGQEPA
GVWVGWVTPDYHYFSNNYNLSKNRTVTVTLGDERGRVHETVRRSNCYMVWAGEVNSGSHS
SSSSNVDLEVGCLIDLATGLLSFTVNGKEIATSYQVEPNTKLFPAVFVRPTSANLFQFEL
TKIKNTMPLSSAIFKSEHKNPVSQCPPRLDVQSISAVLWSRMPNSFLKVETGRVSERHGW
MVQCVEPLQMLAVHIPEENRCVDIMELSEQQDMQQFHYHTLKLYCALCALGNTRVAHALC
GHLDQSQLLYIIDNKYLSGMLREGFYSVLISIHLETAREARLMMNNEFIIPVTPETRSIR
LFSDASKRHLPPGVGLSTSLKPRLNFAPPCFVGSKREQHLYSPQIPLDXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICELLHYFCDC
ELKHRIEAIASFSDHFVSKLQHNQKFRYNELMLALNMSAAVTARKTKEFRSPPQEQINML
LNFSTGDDCPCPEEIQEELYDFHNELRLHCGIPMEEEEEALDTSIKGRLLALVQKIKGQQ
QKAEKEPAEMQETAPSNLKELISQTMVCWAQECQIQDPELVRKMFSLLRRQYDSIGELLG
AMRKSYTISGVSVQDTINLLASLGQIRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHPN
LMRVLGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSY
LLENSSVGLAPSMRGSTPLDVAASSVMDNNGLALALEEPDLDKVVTYLAGCGLQSCPMLL
AKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENSNVVVKLLIRRPECFGPALRGGGNG
LLAAMKEAIKISETPALDLPGSVHGISSDASADGEDEEEVVHMGNAIMSFYSALIDLLGR
CAPEMHLINKGKGEALRIRAILRSLVPTEDLVGIISIPLKMPVVNKDGSVTEPDMSACFQ
PDHKAPMVLFLDRVYGVEEQGFLLHLLEVGFLPDLRASAFLDAEGLRTSESALAMNRYIG
SAMLPLLTRCAPLFAGTEHYAALVDSTLHTVYRLSKGRSLTKAQRDAIEECLLAVCKYLR
PSMLQQLLRRLVFDVPLLTEYCKMPLRLLTNHYEQNWKYYCLPSGWGSYGMASDEELLLT
KKIFWGVFDSLSQRKYDSELFKMAMPCLSAISGALPPDYVDASINTNVEKPASVDAHGNF
DPKPINTSNISLTDKLEYFANKYAEHSHDKWSAEKVLLGWKYGECVDEKAKTHPQLRMYK
GLTEKEKDIYRWPIRDTLRSMLAMGWVVDRSKDGESMSQQSEKMRKISQASQANGFNPTP
IDTSNVVLSRDLQGMVDVLAENYHNIWAKKKKSDLGSKGGGTHPLLVPYDTLTAKEKARD
REKAQDLFRFLQINGYVTTRGMKDMEQDSSSMEKRFAYKFLKKLLKYVDSAHEFIAHLES
MAISGKTDRSPHEQEIKFFAKVLLPLIDQYFKNHSLYFLSSPXXXXXXXXXXXXXXXXXX
XXLFCKLAALVRHRISLFGSDSTTMVSCLHILAHTLDTRTVMKSGSEPVKAGLRTFFENA
AEDLEKTFENLKLGKFTHSRSQMKGVSQNINYTTVALLPILTALFQHITQHHFGVDLLLD
DLQVSCYRILNSLYALGTGKNIYVERQLPALGECLATLAGALPVAFLEPQLNAYNPCSVF
NTKSVRERANHGMPDSVEDMCPEMPRLAGLMKDINDMAESGARYTEMPHVIEVVLPMLCN
YLSYWWERGPENLCCTTVTSEHLSLLLGNILKILNSNLGIDEASWMKRIAVYVQPIISKA
RADLLKSHFLPTLDKLKKKTVKVVGEEELLKADSKGDTQEAELLILDEFAVLCRDLYAFY
PMLIRYVDNNRSRWLKEPDRDSNELFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLSF
LTGDNKTKMSKSGGQDQERKHKKRRGEFYSIQTSLIVAALKKMLPXXXXXXXXXXXXXXX
XXXXXXXXKDSDDEVKDHIRQNLHLQEKSEDPAVRWQLNLYKNVVVKSEGHADPGRTINR
IQSISAAVFNLEQVEQPLRSKKCVWQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLQ
AYQRIWIETEEYSFEERLVQDLAKTQPKVEEEEEEVVDTQPDPLHQLILHFSHNALTECS
SLEEDPLYIAYADMMAKSCAEDEEEHYEEEREKTFEEKEMEKQKTLYQQARLHDRGAAEM
VLQMISASKGRLGPMVTFTLKLGISILNGGNIVVQQKMLDYLKEKRDVGFFKSLSGLMMS
CSVLDLNAFERQNKAEGLGMVTEEGSINVSERGSKVLQNDEFTKDLFRFLQLLCEGHNND
FQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVMDEAGQRNFSKALAVA
KQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLD
LQKDMIVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTSDSFK
EYDPDSKGVISKKDFQKSMENQKQYSQSEIEFLLSCAEADENDMFNYEEFVQRFHEPAKD
IGFNVAVLLTNLSEHMPNDGRLSAFRDLAESVLSYFEPYLGRIEIMGGAKRIERVYFEIS
ESSRTQWEKPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQLASQISEPDPVE
RPLLESSSAFTLACVSVSKSLGRLRRLLTARSLRQRYRRFRRMSVREMVRGFFSFFWMII
TGLFHFLYGLVWGFFHILWTTMFGGGLVEGAKNIKVTDILGNMPDPTQFGIHGDALETEK
MEACEASQLAELGQLSQGEEAEADLIAELLYIQPKKEGKHGSEPGLGDVSEVVVGDAPSI
ASAVKQKKAQEAAKKRVTNGDYKGDSENSDWETGEKKDQDKSKEDTPQGSSPEEKRFPKK
RPGLKREPPEAFTASFLAGLEIYQTKMLNYLARNFYNLRFLALFVAFAINFILLFYKVTG
DDADEPDPWNGGGKVAEEEEDEGVVEYFVLQESTGYMAPTLRFLAILHTVISFLCVVGYY
YLKVPLVVFKREKEIARKLEFDGLYITEQPSDDDIKGQWDRLVINTPSFPYNYWDKFVKR
KVIKKYGDLYGAERIAELLGLDKSALDFNPTEETVAXXXXXXXXLSSIDTKYHIWKMGVV
FTDNSFLYLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGL
LAVVVYLYTVVAFNFFRKFYNKGEDDEEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIED
PAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGI
GNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFP
AGDCFRKQYEDQLG
Download sequence
Identical sequences ENSGMOP00000017386 ENSGMOP00000017386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]