SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017614 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017614
Domain Number 1 Region: 65-147
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-25
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-22
Family First domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 211-308
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-20
Family Third domain of FERM 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017614   Gene: ENSGMOG00000016413   Transcript: ENSGMOT00000018048
Sequence length 395
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2012:44059:57411:1 gene:ENSGMOG00000016413 transcript:ENSGMOT00000018048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEVTKSIPKQMKSQPPFTMCLRV
KFYPPDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAHILQAEIGDYDPGKHP
EGYSSKFQFFPKHSEKLERRIADIHKTELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEVTKLKFEGKTFHIYANQKEDKKIILTYFA
PTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMEQSAKI
KREPPEIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLESLRDSAHSTPVRS
VSHGDSFMTRSRSQAADVGGSTSIISDEAYSPSDS
Download sequence
Identical sequences ENSGMOP00000017614 ENSGMOP00000017614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]