SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017730 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017730
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.76e-65
Family BAR domain 0.0000000526
Further Details:      
 
Domain Number 2 Region: 251-312
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017730   Gene: ENSGMOG00000016523   Transcript: ENSGMOT00000018168
Sequence length 317
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3550:206534:220137:-1 gene:ENSGMOG00000016523 transcript:ENSGMOT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKVDTTARAVMDIMTKTNEYLQPNPATRAKMSMINSMSRMRGQEKGPGYTQAETVLGD
SMQKFGRELGEESNFGLALIDAGEAMRELGEVKDALDIEVKQNFIDPLQNLHDKDLKEVQ
HHLKKLEGRRLDFDYKKKRQGKVCEDEIKQALEKFDDSKEIAEQSMFNILEGDIEQVSQL
AALVQAQVEYHSRATEILTQVSTKIEERIRDASSKPRKEFVAKPRTSLDFTFSENHNGGI
VSGAARSPARSPAPMDQPCCRALYDFDPENEGELGFKEGDIITLTNKIDDNWYEGMLQGN
SGFFPVNYVDILVALPH
Download sequence
Identical sequences ENSGMOP00000017730 ENSGMOP00000017730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]