SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017878 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017878
Domain Number 1 Region: 5-89
Classification Level Classification E-value
Superfamily WWE domain 3.79e-26
Family WWE domain 0.00055
Further Details:      
 
Domain Number 2 Region: 79-164
Classification Level Classification E-value
Superfamily WWE domain 1.7e-25
Family WWE domain 0.0014
Further Details:      
 
Domain Number 3 Region: 382-487
Classification Level Classification E-value
Superfamily RING/U-box 2.41e-19
Family RING finger domain, C3HC4 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017878   Gene: ENSGMOG00000016648   Transcript: ENSGMOT00000018317
Sequence length 613
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4015:48059:73630:-1 gene:ENSGMOG00000016648 transcript:ENSGMOT00000018317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVIRCDPRTASVVLGQVDPRLAPYIIDVH
SMHQFRQDTGTLRPVRRSFYDPASAPGQGWQWEWENDAGSWTAYDTEVGIAIQAARDRQQ
PWLDLAPLGFCYLIDFQSMTQINGQTQRCRRIQRRSDLAYPLVSXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMAQSRA
LIASGVPTVPVKNLNGSSPVHPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSDIK
PVPGLGHCCRKTTKKQARKXXXPEEVVKRYLQKVRNPPEEDCTICMEALAGPSGYKGPGV
GGISRAESVGRLAQCGHQYHLQCLVAMYNNGNKDGSLQCPTCKTIYGVKTGNQPPGKMEY
HVIPHSLPGHPDCKTVRIIYNIPPGIQGPEHPNPGKPFTARGFPRHCYLPDSEKGRKVLR
LLLVAWDRRLIFSVGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDPGHLDNVLEELK
AQGITEEECLPKD
Download sequence
Identical sequences ENSGMOP00000017878 ENSGMOP00000017878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]