SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017909 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017909
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily EF-hand 3.66e-22
Family Calmodulin-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017909   Gene: ENSGMOG00000016683   Transcript: ENSGMOT00000018348
Sequence length 218
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3709:49064:56186:1 gene:ENSGMOG00000016683 transcript:ENSGMOT00000018348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASQTRTEDVFQELSDKTGFSLEQIRILHKRFRQLSGEEDTISKENLEKIQALDKNPIR
NQIIEAFFDKRNQNDGEVGSSREIGFQQFVKVMCHFKPPTLKMTTEDKEAMRREKLRFLF
NMHDTDNDGTITLDEYRKVVEELLSKSGAIGLEAAKAIADAAMLEVASINVPHMEPHEFY
EGITFEHFEQILKGLEMESRMNIRFLDVDTSTMHCGKS
Download sequence
Identical sequences ENSGMOP00000017909 ENSGMOP00000017909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]