SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018022 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018022
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-72
Family BAR domain 0.0000000778
Further Details:      
 
Domain Number 2 Region: 274-334
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-19
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018022   Gene: ENSGMOG00000016785   Transcript: ENSGMOT00000018466
Sequence length 336
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2849:44485:57638:1 gene:ENSGMOG00000016785 transcript:ENSGMOT00000018466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSEKISGTEGTKLDEDFMEMERKIEVTNKSVFDLLSKTTEYLQPNPASRAKLGMLNTMS
KMRGQVKTTGYPQTEDLLGDCMLRYGQELGEDSVFGSALMDMGKAMRQLGDVKDGLDINV
KQNFIDPLQNFQEKDLKEITHHLKKMEGRRLDFDYKKKRHGKMPDEEIRLAVDKFEESKD
LAERSMFNFFENDVEQMTQLSALIEAALEYHRQSTHILEELSGNLQQRIATANSRPKRVF
KPKPLLSTFDSYDGSQHNGLSYSSSIKTTGMSEVPDQPCCRSLYNFQPENAGELGFKEGD
LIILTNQIDENWYEGMISGESGFFPINYVDVIVPLP
Download sequence
Identical sequences ENSGMOP00000018022 ENSGMOP00000018022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]