SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018298 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018298
Domain Number 1 Region: 1057-1279
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-29
Family Kelch motif 0.0059
Further Details:      
 
Domain Number 2 Region: 948-1044
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000759
Family Kelch motif 0.033
Further Details:      
 
Domain Number 3 Region: 682-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 768-872
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000807
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 5 Region: 551-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000819
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1667-1717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018298
Domain Number - Region: 1761-1796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00232
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 654-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00273
Family Laminin-type module 0.056
Further Details:      
 
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0262
Family Galactose oxidase, central domain 0.05
Further Details:      
 
Domain Number - Region: 1589-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0381
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018298   Gene: ENSGMOG00000016971   Transcript: ENSGMOT00000018746
Sequence length 2272
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4628:33419:55849:1 gene:ENSGMOG00000016971 transcript:ENSGMOT00000018746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGNVHIHYQEEKCYDEELFFYHLGCHQWVSAGEGLSLREWPPRDDAAWLTGRYSHVATVM
EGRVLLVAGGYSGVARGDLVAYKVPLFVSSDFGDRVDAVCEEAPDESMCLKNPECSLAER
SACRVDQISGPYGWWGERTRFLTALDSCRTDNDVPGLHLLTFQHPRNDSQPDKVAILRST
TISLTPTTEMDVALQFRGFIHPLWGAPPPAHPPTDTVSMWARIQRLHFEARMAPGPTSSQ
LEVVGRWAAQQEKELKLLGRPDGGRLFPNLTRGNHYLVQAEGYLNNSGSGQTSEMALIWN
RTGLPGGSEISFLFLEPYRSGSCWAYTSCLACLSDQSCGWCPSLARCLLRSGPQPCLESR
GGERHLLLAPQHCTLCEEYRDCSACTQDPYCEWQINSNKKGDYQCSRRGRLDGSIRDPMV
CPKVCNQRRSCAECLSNSSQCAWCESAQACFYFAAYLTKYPYGECRHWYDSVHSVPQCKQ
CASMSTCTDCLRTFQCGWCGDHNNPTIGKCLRGDWAGIDDSSAYNCSTAVAEARAAXXXX
XGVWSYPTCPDVEECRLGLHNCHAFATCVNTPTAYECHCERGYTGDGTMHCNQTCYNECR
EGRCSGSPRFECECSLGWTSDPATLVLSGVECDVDCLQLPLHLHHAPGISPLSDWTTGPH
CEHCRPGSFSLALAGSGGCVPCQCNGHGDLLQGFCHNQTGQCYCTHNTQGAHCETCLPGY
YGDPSNNGTCYRQCQGRSVLLSSSSSSPLPLSSSLGWRGEAGGGGLSHCLWVLSTTENLA
PCTAGQFCPPVALTLHPDSHTQCASSYVYVFDGLPRFLGNGVVHPDSNLIGAFCGTTRTQ
PVTVEATSGIISVYFETNVSDATPQGFNASFWVRRCPRGSERGMEDGAPVCQARAQCQGG
LCQCPQGYGGALCDRPLCPQDCGETEGRGSCNLPSGVCVCSENWAGSDCSEPLDPSSLVW
ETLLDTQLKANQAHRFLHRMGHSLVSGPLGNLWMYGGLSLSEGILGNVYRYAVSEQKWTQ
MLTSSLDGGSLPVPRYQHAAALLTNMDPPSGGQGSSHNFMLVVGGVTQKGVAMDTWSLNL
SSLVWREYKSSILPQVAGHTLTVRREATVLLIGGYSPENGFNHQLLEFGVQSGNWTVTPH
IGTPPTGLYGHSAVYHEQTDAVYVFGGYRFHVETVEPSGELYSLYYPNLTWSLLVPSQGN
KPQFRFFHAAALIKDTMVIVGGRSAEEDYSNTVSLYQINCNTWINAVPSVGEPVNQSVSL
AMTGLGGRLFLSGGFNGVTLGRLLTLTVPADPCSLLSTPESCNVTTGSCVWCSGACTSSD
AAERMGCSSSLAPCSPSPKQPDQCRRLKTCSECLARHPRAFSSPTQPALQCKWCTNCPEG
ACISSSVSCTSEHDCRINQREIFLSSNCTETSCEASDCPKCTASGKCMWTRQFKRTGETR
RILSVNPTYDWTCFSYALLNVSPMQVESSPPLPCPSPCHSLHSCSLCLGSRGSDGGWQHC
VWSMALEQCMSPSFVPLRCEAGQCGRLLSGGDSCSPQCSQITQCSRCIARPQCGWCAAHG
GNGAGRCQQGGLDGGDTVCPTSNGSWSFLYCPEEDECANAHHHCNATQDCHDQPGFHCTC
KHGYLLSSVSGQCEPQCVQGCLNGTCVSPGVCQCHFGFVGENCSSQCSCNKHSNCAGVSR
RDECLECHNNTIGKHCEKCKPLFVGSAKGGGACRPCREFCRGNSALCLSRDEHKKALDNG
NAFPLDSVSIQTWVSEGPSEESAVCVSCRNNSVGDKCESCLSGFFLLQGKCEKCQCNGHA
DTCIEHDGTGCPCQNNTETVQCPSTSSSDRKDCYRQQCAKCKDSFNGTPVNGRQCYRQFN
VDSECCFDPTSQTNCFHDPSIRNLPRGRTVFFSAQPKFTNVDIRVTIDVTFGEVEVYVSN
SHDTFTVDVHRLTGVHAIRIEDDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQQAK
PPGAEREVREERAEGLISYITVWKPQTVLVVRGVRDRVVITFPHEVHSLKSSRFYIALRG
VGTEQRQGESQGLLFLRQDQAHIDLFVFFSVFFSCFFLFLSVCVLLWKVKQFLDFRREQQ
RHIQEMTKMASRPFAKLTVYLEPEEPXXXXXXXGAPPPPPPPPPPQPGQRGERRAAPAPA
LPQHPPLHRHGHHRPPGTPPPPPLMGFSYSSFKVGPITLEPTDDGMAGVATVLIQLPGGI
LAPNRACLGSALVTLRQNLQEYCGHGNAGTHPGGGGGRKGLLGHQHLTTMAM
Download sequence
Identical sequences ENSGMOP00000018298 ENSGMOP00000018298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]