SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018449 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018449
Domain Number 1 Region: 293-574
Classification Level Classification E-value
Superfamily Kelch motif 8.63e-83
Family Kelch motif 0.000000000407
Further Details:      
 
Domain Number 2 Region: 21-144
Classification Level Classification E-value
Superfamily POZ domain 4.45e-30
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018449   Gene: ENSGMOG00000017172   Transcript: ENSGMOT00000018904
Sequence length 599
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3792:1914:42222:1 gene:ENSGMOG00000017172 transcript:ENSGMOT00000018904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTECKALVTPSTRNGHRVFSYTLGSHTAAAFAIMNELRQERQLCDVTLRVRYNDLDAVDF
VAHKVVLASSSPVFRAMFTNGLKECGKEVVPIEGIHPRVMERLIEFAYTASISVGEKCVI
HIMNGAVMYQIDSVVKACCDFLVQQLDPSNAIGIANFAEQISCTELHQKAREYIYMNFSQ
VATQEEFFNLSHCQLVTLISRDELNVRCESEVFHACVAWVRYDQENRRPYVQALLQAVRC
HSLTPNFLQTQLQSLDWDWDPQCKDYLAQIFQDLTLHKPTKLNSCRTPKVPQLIYTAGGY
FRQSLSYLEAYNPCTGAWLRLADLQVPRSGLAACVISGLFYAVGGRNNAPDGNMDSNTLD
CYNPMNNCWLPCAPMSVPRNRIGVGVIDGLIYAVGGSHGCIHHNSVERYDPERDQWQLVA
PMMSRRIGVGVTVINRLLYAVGGFDGTHRLSSSECYDPDRDEWSPMSSMHTVRSGAGVCA
LGNRIYVMGGYDGTNQLNTVECYEVETDSWSLAASMRHRRSALGVTAHHGRIYVLGGYDG
NTFLDSVERYDPETDSWSEVTLMTSGRSGVGVAVTMEPCQKDLQTCASERDGGSASPPV
Download sequence
Identical sequences ENSGMOP00000018449 ENSGMOP00000018449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]