SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018508 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018508
Domain Number 1 Region: 33-500
Classification Level Classification E-value
Superfamily Sema domain 1.31e-125
Family Sema domain 0.000021
Further Details:      
 
Domain Number 2 Region: 1340-1469,1685-1873
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.61e-51
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 1033-1136
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000106
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.061
Further Details:      
 
Domain Number 4 Region: 848-917
Classification Level Classification E-value
Superfamily E set domains 0.000000000000439
Family Other IPT/TIG domains 0.0096
Further Details:      
 
Domain Number 5 Region: 503-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 946-1035
Classification Level Classification E-value
Superfamily E set domains 0.0000000000187
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 7 Region: 1134-1224
Classification Level Classification E-value
Superfamily E set domains 0.000000196
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 8 Region: 802-835
Classification Level Classification E-value
Superfamily Plexin repeat 0.000017
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018508   Gene: ENSGMOG00000017171   Transcript: ENSGMOT00000018963
Sequence length 1904
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1936:259499:399398:1 gene:ENSGMOG00000017171 transcript:ENSGMOT00000018963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLLLLLPLSLAPPGAVPSLCGGQPPPFRRFSPQESGLTHLAIHNKTGEVYVGAINWI
FKLSSNLTKLRNHMTGSVVDNEKCYPPPSVQSCPHELSQTPNVNKLLLIDYAQNRLIACG
STSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAESGTMSGVIISSPHNPTSKLFIGTPID
GKSEYFPTLSSRKLMENEENADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFSS
EHFVYYLTMQLDTQLTSPDASGEQFFTSKIVRLCVDDPKFYSYVEFPIGCTKDGVEYRLV
QDAYLARPGRLLANSLGISEDEDILFTVFSQGQKNRAKPPKESALCLFTLRRIKEKIKER
IQSCYKGEGRLSLPWLLNKELACINSPLQINDDFCGQDFNQPLGGTSTIEGLPLFIDKDD
GMTSVAAYDYRGNTVVFVGTRNGKMKKILVNSVSPNSPALLYEKVTVSETGSPLLRDMLF
SPDQQHIYTLTDKQTSRVPVESCEQYTSCGECLGSRDPHCGWCVLHNVCSRKDRCDRASE
PQRFASDQRHCVELSVAPRNISVTMSQIQLVLQAHNVPDLAAGVNCSFEDYVETEGRIQG
GRIYCLSPSARDILPITRNRGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVN
GSYPCHWCKYRHMCTQNVNDCSFQEGRVNISEDCPQILPSTQIYIPVGVTKPITLAAKNL
PQPQSGQKNYECVFHIQGETYSVTALRFNSTSIQCQKTSYTYEGNDISDLPVNLSVVWNN
NFVIDNPYNIKAHLYKCPAMRDSCGMCLKADPRFECGWCVQEKKCSLRQECAPAESSWMH
ATTGNSRCAHPKITKLSPETGPTQGGTMLTITGENLGLHFKDIQNGVRIGKVTCIPQEDQ
YISAEQIVCRLADATGYSVQDARVEVCVRDCIHPDYKATSVKSFTFVSPYFTRVHPSNGP
LSGGTKITIKGNSLNAGSAVALKIGLHFCRFERRNEKEIVCVTPVGKNLGPTPVMVDINA
AELRNPEVKFNYTDDPTILRIEPDWSIASGGTLLTITGTNLATIKEPKMRAKYGAAKSVN
NCTVVNNTVMVCLAPSVAASEKGFSETGSGPDEIGFVMDDVRSVMVVNETFSFYPDPVLE
PLSPTGMLELKPSSPLILKGRNLIPAAPGNSKLNYTVFIGETPCILTLSESQLLCEWPNL
TGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIVVLIAYKRKSRD
ADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLF
PGIEDHPVLKEMEVQANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLI
MTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFL
KECAGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLXXXXXXXXXX
XXXXXXXXXXXXXXXXPEGEAGTEVPVKVLNCDTVTQVKDKLLDSVYKGIPFSQRPQADD
MDLGMWRQGRMARIILQDEDVTTKIDNDWKRLNNLVHYQVTDGSVIALVPKQNSAYNISN
SSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGDRGS
KMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSIS
DSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG
KDSPSNKLLYAKDIPNYKNWVERYYSDISRMSAISDQDMSAYLAEQSRLHLSQFNSMSAL
HEIYSYIVKYKDEILSALERDEQSRRQRLRSKLEQVIDTMALAS
Download sequence
Identical sequences ENSGMOP00000018508 ENSGMOP00000018508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]