SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018750 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018750
Domain Number 1 Region: 72-178
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-32
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-23
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 238-317
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000117
Family Third domain of FERM 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018750   Gene: ENSGMOG00000017430   Transcript: ENSGMOT00000019208
Sequence length 434
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3816:622927:644917:1 gene:ENSGMOG00000017430 transcript:ENSGMOT00000019208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVIFPLRRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFSKSIAKQMKSQPP
FTMCLRVKFYPPDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGD
YDPGKHPEGYSSKFQFFPKHSERLERRISDIHKTELIGQSPDTSELNFLQKAQSLETYGI
DPHPCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKK
IILTYFATPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVM
EQSAKIKRDPPEIHRAGLVPSRSCPSITHGPRLTSVPRTRRRAVHISIMEAPADVEELNK
FVLSVLRLFLVTMGLLGALLLLLLVLTESDLDIAFLRDIRRTPEFQQFHLEYFCPLRRWL
ACKVRWMGGFLVSQ
Download sequence
Identical sequences ENSGMOP00000018750 ENSGMOP00000018750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]