SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018787 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018787
Domain Number 1 Region: 122-394
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-47
Family Kelch motif 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018787   Gene: ENSGMOG00000017482   Transcript: ENSGMOT00000019245
Sequence length 448
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3898:55264:67081:-1 gene:ENSGMOG00000017482 transcript:ENSGMOT00000019245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLSWEQWEEEAWTDEVTLSITLEGGNLVPLQCTTAAPAAREVKGKRKRGQQAVEEEEEYK
TESHENVCPNGRSEKKTPPGRKVRANGTAEVKGIVGKTPPHRAGKPRGRPAKAPTQSVTL
ASPSGRWGHTMCPIDAQTAIVIGGQGARMQFCKDPMWKLCTEDVSWLAAETLATGPTFEG
RTGHTSVYDPVSGRIFVFGGSKNKKWFNDVHILDTHSWRWTMVEXXXXXXXXXXXSCSLF
GGELFVLGGVFPLPHPQPDGCSDSLYIFDPYRSIWYQPIVTGDKPSPRSGHSACVMQKRL
IYVFGGWDTPVCYNDMYTLDLGLMEFSAVKTTGKAPSPRSWHGSVALSDTQFLIHGGYNG
HTALNDAFIFDIDTSCWSEVSLPEFSVPRAGHSIISMAMAADGRFDRGGEEEEEQGGGAS
RSLLVFGGGDNEGKFYSDLMVVSIEELL
Download sequence
Identical sequences ENSGMOP00000018787 ENSGMOP00000018787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]