SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018813 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018813
Domain Number 1 Region: 614-682,909-1244
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-116
Family Ras GEF 0.0000205
Further Details:      
 
Domain Number 2 Region: 23-123
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-19
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 3 Region: 227-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-16
Family DBL homology domain (DH-domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 427-583
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000108
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 5 Region: 380-438
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000114
Family DBL homology domain (DH-domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018813   Gene: ENSGMOG00000017486   Transcript: ENSGMOT00000019271
Sequence length 1246
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3816:686072:723216:-1 gene:ENSGMOG00000017486 transcript:ENSGMOT00000019271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGMRLNDGHVTYLALLAKKDGTRRGGLSKKSSDNTKWHAKWFALLQNMLFYFENDSSS
RPAGLYLLEGCACDRAPSPKPSLRXXYYFTITFNHDNQKALELRTEDVKDCDEWVAAITQ
ASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEVIAGLLKDN
EKIQATPEVPPSDDDTELKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRKRNQVV
FSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQ
GLKARIASWPTLVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIPRYILTLHELLAHTPHEHVERTSLDYAKSKLEELSRIMHD
EVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSERGKITRGRLGSLSLK
KEGERQCFLFSKHLIICTRGSGGKLHITKNGVISLIDCTLMEELEGTDDETKPEKTGQDV
EHLDFKVIVEPKDIQSYTVILVPSSRQEKAAWTSDISQCIDNIRCNGLMMNAFEENSKVT
VPQMIKSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLH
SYRVFSSADVVLDKLITIYKKPISAIPARSLELFFASSQSNKLLYGEPPKSPRASRKFSS
PPPLSITKTSSPNRRRKLSLNIPIITGGKALDLAALGCSPNGYTGLHSTVSPFSKTTLDI
NKLYVSSKTPPDDGDTKAEGKAEDSPLSKQDMAVREVCDEEPPPSDEVEAEMSPPKSPST
PKNVKAKNSEFSLFSFNNGMVVSSCRELDNNRSALSAASAFAIATAGANDGTPTKEKYRR
MSLASTGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHAQDFEVNTELKLRVISFLEE
VMHDPELLTQERKAAANIIRTLTQEDPGDHQISLEEITRMGLEGGKSEPFESHSALEIAE
QLTLLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIMKTTKHFNDISNLIATEILKWDDVN
LRVGVLEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQK
LVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDQLVNFSKMRMISHI
IREIRQFQQTAYKIDYQPKYLLDSSSVLDEESLYEASLRIEPKPSS
Download sequence
Identical sequences ENSGMOP00000018813 ENSGMOP00000018813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]