SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018840 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018840
Domain Number 1 Region: 48-164
Classification Level Classification E-value
Superfamily POZ domain 2e-33
Family BTB/POZ domain 0.002
Further Details:      
 
Domain Number 2 Region: 302-508
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-32
Family Kelch motif 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018840   Gene: ENSGMOG00000017530   Transcript: ENSGMOT00000019298
Sequence length 543
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1298:31463:35689:1 gene:ENSGMOG00000017530 transcript:ENSGMOT00000019298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVASDPVCSAWPPLRAGFWMESAEESGLSVGGSVGEENYFLGYTFTDRSHSSRVVKSIM
DLCLEDGLFADVTINVDGKEFQLHRLVLSAQSSFFRSMFTSNLKESHNRSIELKGVSATV
FQLLVDYIYHGTIKLRVEDLQDTYEMADMYQLTALFEECSRFLSRTVEVKNCLQVMWLAD
RHSDQELYTAAKHCAKIHLVQLNQTEEFLNMPLCLLLDIIKDGVPSSQNPKVAIDSWINH
NKVEREEFSCVLRENLKEIGEKVHIYLIGKEETRTHSLAVSLHCDEDDSVSVSGQNSLCH
QITAACKHGGDLYVVGGSIPRRMWKCNMHTMDWERCAPLPRDRLHHTMVSVPGEDAIYSL
GGKTLQDTLSNAVIYYTAKDNMWTESSQLDTAVSGAAGVNLGGTIYLLGGEENDMDFFTK
PSRLIQCFNTATHKCQIKPYMLPFAGCMHAAAHMDVIFVVAEGDSLVCYNPLLESFTRLR
FPEVWSSVPSLWKVASCNGSIYVFRDKCKKGDANTLKFNPATSVVSVIRGIKILLTNWQF
VLA
Download sequence
Identical sequences ENSGMOP00000018840 ENSGMOP00000018840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]