SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018859 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018859
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000068
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 2 Region: 215-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000196
Family I set domains 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018859
Domain Number - Region: 162-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000322
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018859   Gene: ENSGMOG00000017549   Transcript: ENSGMOT00000019318
Sequence length 307
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4309:5597:13702:-1 gene:ENSGMOG00000017549 transcript:ENSGMOT00000019318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARASQVLVPQKVNAVLGKNVTLECQVEVGTNLSLTQSSWERRLPTGAVTVAVYNPLFGI
SVPPEYAGRLTFRSPSSHDATILLSDVGFSDMGVYTCKVATFPLGNTQAATTVNVLXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSWESALFGQSDVQLWDEPNGTTSTRVR
YLWQPTRHTQSHGLTCVVRHPALPADHRIPYQLNVLYAPDISVVGYDGDWYVGRENVQLT
CRANANPPAHHFRWIRLDSDVWPDGVERLNNTLLFLRPLQRNDSGVYRCEVANSIDLRSR
DLRILIQ
Download sequence
Identical sequences ENSGMOP00000018859 ENSGMOP00000018859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]