SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019004 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019004
Domain Number 1 Region: 524-628
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-28
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 93-246,527-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.093
Further Details:      
 
Domain Number 3 Region: 759-787
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000156
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019004   Gene: ENSGMOG00000017654   Transcript: ENSGMOT00000019464
Sequence length 802
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_144:56746:128869:1 gene:ENSGMOG00000017654 transcript:ENSGMOT00000019464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGAPTRGDAHELFDELVGATTCRATLRAFGLLCDHLGVPGGAVPGDPRQWPFYHTVKH
RLNYWKANALWAKLDKRAALPEYMTGRACAGTTCVVIGAGPVGLRTAVELAFMGARVVLV
EKRDAFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCGASIDHISIRQLQLILLKVALLLGV
EVHVNVEFKQLVEPPGSQEHHKAGWRLEVHPKTHPVSQLDVDVVIGADGRRNTLPGFKRK
EFRGKLAIAITANFMNRHTTAEAKVQEISGVAFIFNQRFFQELRQETXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSPRSNKLLAWCQEQTRGYR
AVAVGDLTTSWKSGLALCALIHRHRPHLIDFDSLGESDAEANVRLGFSVAQRELGIAPLM
TAEEMCSAEEPDSLSMVMYLSQFYQLLRETLPPGGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGGSGRSRVRLMANQLQARLDSTPPPA
KVPPPRKTIDTSRGQNRPXXXXXXXXXXXXXXXXXXXXXGVCFFCSQRVYVMERLSAEGL
FFHRSCFQCDHCRTTLRLSSYA
Download sequence
Identical sequences ENSGMOP00000019004 ENSGMOP00000019004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]