SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019108 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019108
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-24
Family Pleckstrin-homology domain (PH domain) 0.00000327
Further Details:      
 
Domain Number 2 Region: 136-188
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000282
Family Protein kinases, catalytic subunit 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019108   Gene: ENSGMOG00000017678   Transcript: ENSGMOT00000019570
Sequence length 191
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4384:131616:133528:1 gene:ENSGMOG00000017678 transcript:ENSGMOT00000019570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVRTLKEGWLLKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQSSPPLNNFSVAAE
CQLMKTERPRPNTFVIRCLQWTTFIERTFHVDTNDEREEWMRAIQAVANGLKMREEEDEE
PMDLFGSPSECSLEEMEVAMSKSRTKTNMSDFEYLKLLGKGTFGKVILVKEKSTGVHYAM
KILRKEVIIAK
Download sequence
Identical sequences ENSGMOP00000019108 ENSGMOP00000019108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]