SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019125 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019125
Domain Number 1 Region: 203-326
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 5.36e-55
Family Dystroglycan, domain 2 0.00000227
Further Details:      
 
Domain Number 2 Region: 489-589
Classification Level Classification E-value
Superfamily Cadherin-like 5.18e-16
Family Dystroglycan, N-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 87-177
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000033
Family Dystroglycan, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019125   Gene: ENSGMOG00000017787   Transcript: ENSGMOT00000019587
Sequence length 884
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1610:289388:293171:-1 gene:ENSGMOG00000017787 transcript:ENSGMOT00000019587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGISRRSKLPPGRTIPLIMGLLVALAQGTLPGAQQDTVVEMMSVELEASMQSFALSEFQ
ATLAAVAKAQPPPVQGPAAVTEGLHVGLHDSSAVVGQVFQMRVPPRPANGSCNIHLTAMG
KETLASWLHWDTERCVLSGMALEQDKGVHHIAVTGGELNAKVPGQVAPPSAVFSIEVFPE
ERTDAEPALLTLQSDISGLQPFTCGTEEHVTVLTVILDADLTKMAAKERVALMDVMREFS
HVPLEHMWAVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCALDQSSIPNINSVQ
SPAKDGSMSAKLGYPVVGWHIVNKKPNGVRRVRRQLHNTPTPLPSLLPPTTQPEPPVRVV
PTPTSPSIAPATEISAPPVRGPLPLPVKPTNRLRDQIAHTPVLGPPQPTRVIGTTSSMPI
QPTMTRPTIIEATAIPTPPSTTKKPRPVATKKPKKPKTTSPAPREPKPTIPKPPRRPTSC
LLPEENQRPTIHNPIDEVNAWVGTYFEVKIPPDTFYDREDGTTDKLRLSLKKTPNEAVTE
SSWIQFNRTIQLLYGLPESEHEGTHEYFMLATDKGGESIMDAFEVHVNRWTANDKPSVVF
SARFHGDPKSLNDDVQRKILLTKKLAYAFGDRNSSTVTLRSITKGSIVVEWTNNSLQQSP
CPKDQITVLSNKISDPQGKPKLPFIKAMEPEFKPINISIRGTNKCQSYTFVPPGELPAPV
APTPTDASGPGRRSSDDVYLHTVIPAVVVAALLLIAGVIAMVCYRKKRKGKMTIEEQATF
IKKGVPIIFADELDDSKSPPSSSIPLILQEEKPPLPPPEYPNMAGPHSTLLHQDLLEEYS
IYQDEDPNAPPYQPPPPFTVPIEGKGSRPKNMTAYRSPPPYVPP
Download sequence
Identical sequences ENSGMOP00000019125 ENSGMOP00000019125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]