SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019665 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019665
Domain Number 1 Region: 291-570
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-46
Family Kelch motif 0.00049
Further Details:      
 
Domain Number 2 Region: 12-127
Classification Level Classification E-value
Superfamily POZ domain 9.94e-35
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019665   Gene: ENSGMOG00000018279   Transcript: ENSGMOT00000020144
Sequence length 626
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1223:96553:102625:-1 gene:ENSGMOG00000018279 transcript:ENSGMOT00000020144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLGERRAVNTDYAVSLLEQLKFFYEQKLLTDVVLLVEESEFPCHKMVLATCSSYFRAM
FMSGLSESKQTHVHLRNVDPTTLQVIITYAYTGNLAINDSTVEPLYETACFLQVEDVLLQ
CRDYLVKKINAENCVRMLSIGDLFSCSELKQSAKRMVEHKFPTVYRQQAFLQLSHELLVD
VLSSDNLNVEKEETVREAAMLWLEYNMEARSQHLSSVLSQIRIDALSEVTQRAWFQGLPP
NDKSVVVQGLYKSMPKFFKPRLGMTKEEMLIFMEAMWVAEGIHLMAGVVPAVCYSPQAEK
LYRLSDPPGDLQKVGTLVSPDNDVFIAGGQLTLKNSVGKAGKLQTVYRSVDSFYWLDAQQ
NAWVAKTPMLCARIRPSLVWCEGYIYAIGGDNVGGELNKRTVERYDCEKDEWSMTSPLPC
AWNWSTAVVAHDCIYVMTHDLMYCYFPRADTWVEMAMRRTSRCFASAAAFGDLIFYIGGL
HVVSNTGVRLPTSTIDGSSVTVEIYDVNKNEWRLAANIPAKRYSDPCVRAVVLLNALCIF
MRETHMNERAKYAIYQYDAETDRWFLRQPVSERSLWDMGKDFRCAVGKLYPSCLEESPWK
PPTYLFAPDGAEEFEVDGEMVPLPHV
Download sequence
Identical sequences ENSGMOP00000019665 ENSGMOP00000019665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]