SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020564 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020564
Domain Number 1 Region: 177-383
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.95e-30
Family Phospholipase D 0.03
Further Details:      
 
Domain Number 2 Region: 19-159
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-24
Family Nuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020564   Gene: ENSGMOG00000019115   Transcript: ENSGMOT00000021066
Sequence length 384
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2572:194892:204936:-1 gene:ENSGMOG00000019115 transcript:ENSGMOT00000021066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVLVESIPEGLVYNGSTANPSIYQAWLNLIGEARSSLDIASFYWTLTNKDTGTKEPTANQ
GEDVLKRLGELSGKLPVRIAVDLQKDKHAIIRSVNMRGLTNGVLHTKFWIVDKKHIFIGS
PNMDWRSLTQVKELGVVVYNCSCLAEDLGKIFEAYWFLGQSGQEIPATWPSNFSTAYNKD
TPLQLPLNDTQSGVYLSSSPPSVCAAGRTSDLQAVLSVIQDAEEFVNIAVMSYVPMMEFS
RPKQYWAEIDTQLRRAASKRPKVRLLISDWAHSQPFMPPFLKSLASIYDPKHKLDIQVRL
FVVPANPSQKLIPYARVNHNKYMVTDKIAYIGTSNWSGDYFVNTAGVALVVNQTASQTEE
PTVQSQLKAVFDRDWYSAYSTPID
Download sequence
Identical sequences ENSGMOP00000020564 ENSGMOP00000020564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]