SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020740 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020740
Domain Number 1 Region: 216-284,340-376
Classification Level Classification E-value
Superfamily Second domain of FERM 4.27e-16
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 2 Region: 380-466
Classification Level Classification E-value
Superfamily PH domain-like 0.0000738
Family Third domain of FERM 0.036
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020740
Domain Number - Region: 120-210
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000448
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020740   Gene: ENSGMOG00000019287   Transcript: ENSGMOT00000021247
Sequence length 485
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2045:535451:538652:-1 gene:ENSGMOG00000019287 transcript:ENSGMOT00000021247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVSDPVPIIQGILQTCQDLRPLRDEVYCQLIKQTNHVPQPNSLANRAHWHLLTCMGCT
FLPSRGILRYLKFHLKRIKELFPGSEIELFAHFIGESLKKTKCREYVPSQEEIVALLTRQ
EMTTTVYCHGGGSCKISINSHTTAGEVVEKLIRGLAMEDSRNMFALFEHKNNIDRAVESR
VIVADVLAKFERLAGSEEEEDEGHWKLYFKLYCFLDVESMPKEGVEFAFMFEQAHESLTS
GHFPAPEDTLQHLGALRLQFLHGDKARVNWTLENVYPMGRLRSRILHFTKAGAGAAGQTG
QTLERRRTSFLEGTLRRGLKTGSMKKQRMEEEQMLEMWVKEETSATRASILEKWSRIRGL
DQHQAMLKYMTIIKEWPGYGSTLFDVECKEGGFPHDLWLSVSAENISVYKRGDPKPLETF
PYEHIVFFGAPQPCTYKITVDEREMLFETPQVGEITKIMKAYINMIVKKRCSVRSVSSYG
TNWIR
Download sequence
Identical sequences ENSGMOP00000020740 ENSGMOP00000020740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]