SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021533 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021533
Domain Number 1 Region: 107-344
Classification Level Classification E-value
Superfamily Kelch motif 5.36e-38
Family Kelch motif 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021533   Gene: ENSGMOG00000020046   Transcript: ENSGMOT00000022051
Sequence length 379
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2852:1628:2764:1 gene:ENSGMOG00000020046 transcript:ENSGMOT00000022051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GERPALGANELVEAIEVAAFLQVRALTGHLVDLIDSDNCLLMCHTAFGYGVRELAHRAAL
FIRDMRSELREELWSLPAELVEYIDSLAPCNYMAVCSHAPSPELLQDIQRTVCYLDEDSR
DWRVLTHLPKESSTTQAGLAVLDNKLYIVGGVHDVSKKVMDCGFCYSPITDTWSTVPSPK
QPRYNFTLIGHEGCLYAVGGEYNRKAISSVEKFKVSHGAWSFASHLPCPAASVASAKARS
RIFVCLWKAKGATDIHEYVPQEDRWLLVTTLVRKQSYGLCMVAHRDNLYVMRNGPCDDFL
MCVMDQYNLTSGQWSAVKGQYGNSKGSLLTAAVRGDSVFTLNRTVTTEYAIEDSRWRTKR
DMKGFGRIGSIYTFLLRIP
Download sequence
Identical sequences ENSGMOP00000021533 ENSGMOP00000021533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]