SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021607 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021607
Domain Number 1 Region: 7-93
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000126
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 189-265
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000183
Family Kelch motif 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021607   Gene: ENSGMOG00000020120   Transcript: ENSGMOT00000022125
Sequence length 265
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4221:40404:41198:-1 gene:ENSGMOG00000020120 transcript:ENSGMOT00000022125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEKVVAIVMDDKTYEVDKHKLIENSDYFRALYGSGMRESTADSVQLQGLSGQGLELVL
GFINTSKVHIVDETLEDLIETASFLQVTPILKLLPSEIRPENCVDLYRLSEVYGTNDLRH
ACLQFMTCHYHPMLRRPEFHQLSPELRDQVREMRMTGTATLLAIGDFTRVAAPSDGAAAG
RLHQDGAAPWSMLRYGDAERWWKPLFSHNLPSDMRNVRGYGYTVLHNYLFIVGGYRVASQ
EMSAAHCYNPCRNEWAQIAPLNQKR
Download sequence
Identical sequences ENSGMOP00000021607 ENSGMOP00000021607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]