SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021699 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021699
Domain Number 1 Region: 193-417
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-45
Family Kelch motif 0.00023
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily POZ domain 2.93e-16
Family BTB/POZ domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021699   Gene: ENSGMOG00000020212   Transcript: ENSGMOT00000022217
Sequence length 462
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1432:13714:15099:-1 gene:ENSGMOG00000020212 transcript:ENSGMOT00000022217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDLVIEVGGQKINAHKEILAEKSDYFKARLSRDILKVKGLSYKTLSVLIDYIYTARMTVS
KDTVVDVITGAKILQVPCAVQAAVDSMSEQLTAENCYEVLSIAKKQRLGELKETAYRFMS
DHFLRVLRDPSVYGRLTGSERDLILRKRTEGRPTLMVAEVNDVFDRVGGSRPASRCSSRP
QSPLSTASFEEGHAMYYYNETAGDWRALTAMPEDINTKGCGMCTMYNYLFVAGGIKGYGE
RGKVSDRVFYYNPVDDRWTEVRPLNQARAQLKLVSMDGHLYAIGGECLFTVERYDPRTDR
WTTVAPLPKGAFAVAHEATTCNGELYVSGGSLFYRLLKYEPKRDEWQECPYNSSRKRSSD
MVALKSFIYRFDVHREQGVDVFKYNTIVKMWQDCASQSLGGVSPFRCAVIGNCIYCVNKS
QTLQFVVEEEGAHFVEEALRPPLEAKGVLFPFVLSLPEKHEA
Download sequence
Identical sequences ENSGMOP00000021699 ENSGMOP00000021699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]