SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000020 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000020
Domain Number 1 Region: 1346-1450,1664-1850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.57e-38
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 262-448
Classification Level Classification E-value
Superfamily Sema domain 1.96e-34
Family Sema domain 0.01
Further Details:      
 
Domain Number 3 Region: 2-116
Classification Level Classification E-value
Superfamily Sema domain 1.31e-31
Family Sema domain 0.00088
Further Details:      
 
Domain Number 4 Region: 893-984
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 451-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 981-1026,1069-1122
Classification Level Classification E-value
Superfamily E set domains 0.0000000442
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.093
Further Details:      
 
Domain Number 7 Region: 800-895
Classification Level Classification E-value
Superfamily E set domains 0.00000013
Family Other IPT/TIG domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000020
Domain Number - Region: 1137-1191
Classification Level Classification E-value
Superfamily E set domains 0.00385
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number - Region: 605-643
Classification Level Classification E-value
Superfamily Plexin repeat 0.0562
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000020   Gene: ENSGMOG00000000012   Transcript: ENSGMOT00000000020
Sequence length 1883
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4421:27844:67309:-1 gene:ENSGMOG00000000012 transcript:ENSGMOT00000000020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTRNDTDFQHLLLHPDPAVGTVYVGARDHLFQLDGLEGLRLQQEETTGPVKDSKDCLPPV
TEANCPQARWTSNHNQLLLVDPWAAELITCGSVHQGTCQKRSLTSVSQVLFSSERPVDTQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVGQSRGPDGDTLLGVFAAHLSSANTETSEASALCRFSLDQLDR
SIDSTRDLCYTQXXXXXXXXXXXXXXXXXXXXXXXXXXNTLEAYPCGSDHTPSPMASRIP
LEAEAVLVSRSARLTAVAVDVREGHSVAFLGDSKGNLHKVFLGSDGQVKTYAVASVRPNA
PIHGDLLLDHSRAQIYIMTSNTVEKRPVAECGDHLDCDSCLSARDPYCGWCVLDGRCGLR
EDCQRGSLGGHWLWSFDEAQQCLSIQELNVYNVSRGDQTPIRVSVPGLPALGKEEVYSCF
FQDTEAPAILSTTGVTCSTPDAGILPLIGQGDDSVMVTLSLRFLNVTVAETQFTFFNCSL
VQLLSGRRPCQGCVGSRWGCNWCIHQHLCTHKHTCDHGVTIYNQKECPCVEKVESSSLLP
VNVESKITLLGQHLHLFQDEDLDYECVLDVESGFVVVEASVETHPTEQTIFLITCQLHQY
TYKAQVEEYRAVINIRRRNSFVIDSAEDLHVTLFNCSVGRSDCSRCRTAEPRYGCAWCAA
ADSASSCVFGLSCTEEVTHTCPAPVIHFIDPVSGPVEGGTVVTISGSNLGQKPEDVENSV
XXXXXXXXXXXXXXXXXXXIVCETTGSGAEKSGQAVVSVRGGGHGRSTHVFSFQDPILTS
VSPLRGPKAGGSRLRIRGHRLRTGHAGEVSVAIGGVPCLVLTIDDDQINCQSGSSNRTGD
HGITVRFGGTERHLQGITYHYTPNPNITRAAPSKSFLRGGRTIRVSGHNLDVVQEPKLRV
TLSPPDPLPPRRRRRRRRSGGRPGAWGRLRRIVPEPDCPEGTLCGVKQHESLCTVISSSM
IQCTSPAVGPEARRARVRVHFLLDSLQFEFSSVGGEAFSYQPDPMLFPLNRKDRSKPYHH
KPGSIISVEGVNLDLAISKEEVVALIGDGVCTVKTLTHHHLYCEPPAQQPPDRSDEGEGL
NHLPEFTVQMGNLNFSLGRVQYDSQAQMSFPPEAQVGVGVGASVVALMVLIIVLIYRKKS
KQAMRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLQYSTYAERI
FFPGHQESPLRRELDVPEGRRQTVEQGLVQLSNLLNSKLFLTKFIHTLEVQRTFSPRDRA
YVASLLTVALHGKLEYFTDILKTLLSDLVEQYVAKNPKLMLRRTESVVEKLLTNWMSICL
FTFLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNVLI
PAPGADAGSAAQTAPAKVLDCDTITQVKEKILEQTWKGTSFSQRPHVDSLNLEWRAGVAG
HLILSDEDLTSITQGSWKRLNTIQHYKLPDGATVALVPRNGKHQHHYDSHDYMPGEKTPM
LDDGEEGGVRLWHLVKANEEAELPKQRKGSVRERGGERAKAIPEIYLTRLLSMKGTLQKF
VDDLFTAILSTSRPVPLAVKYFFDMLDEQASLHNITDPETIHIWKTNSLPLRFWINILKN
PQFIFDVQASDHVDAVLSVIAQTFMDSCTRAEHKLGRDSPINKLLYARDIPRYKHMVERY
YADIRQAIPASDQEMNSALAELSRNYAGEVNHLVALHELYKYINKYYDQIITALEEDTMA
QKMQLGYRLQQVAAAVENKVTDL
Download sequence
Identical sequences ENSGMOP00000000020 ENSGMOP00000000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]