SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000042 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000042
Domain Number 1 Region: 521-580,759-986
Classification Level Classification E-value
Superfamily ARM repeat 0.0000416
Family Armadillo repeat 0.079
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000042
Domain Number - Region: 336-406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00281
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000042   Gene: ENSGMOG00000000037   Transcript: ENSGMOT00000000044
Sequence length 1392
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1921:428:27122:1 gene:ENSGMOG00000000037 transcript:ENSGMOT00000000044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHKVDLFYKLRHVMSEVIDLRRQLLSGHLTRDQMRDVKKHITVRLDWGNEHLGLDLVPRK
DFELVDADQISVSDLYKMHLSSRNSVQQSSTQGDSSRQRHPEPCRVPVQHHLLVNLKSFT
YNTIGEDTDLFFSLYDLREGNTIXXXXXXXXXXXXXXXXXXXXXXLQDLSNKDMKRDLYI
VCQVIRTGKTGRMLLNDSKKGPPHVQYRRPYGCAVLAMSDVLQTISELKEEKDFVLKVYT
CNNENEWYQIHDNIIRKSSTKYTAPSTNYGLVISLQLLRGDMEQLRRENPLLFGRGVALT
RKLGFPDVIMPGDVRNDLYLTVERGDFERGGKSVQKNMEVTVYVVYADGEPLQDCISLGS
GEPNTAEHRCFVLYHNNSPRWNEALKLPIPIDRFRGSHLRFEFRHCSXXXXXXXXXXRSC
LVSFTPLMREDGTTLSDDSHELYVYKVRPCDENATFSNQGLYLSMPCCKEDFNSCPNLPA
NLPFQRSPKETFWVSTLLCSTKLTQNVDLLALLNWKAHPDRVLDILGRLRQISGEEIVKF
LRDVLDTLFCLLDDNTDKYGPLVFQSLVFIINLLRDSKFYHFRPVMDTYIQKHFAGALAY
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQALEYIFKFIVQSRLLYSRA
TCGQEEEEFHCSVHQLFTSLRFVLSLDARHTDTLLFSQAALLSSFPAIFEELLQVFSVQE
VCELVRGALGCMPSTLHMGHSMDVVRLQSIARTVDSPLFAYPAESRRILLPVVLHHIHLH
LRQQKELLICSGILSSIFSIIKTSSLEEVEMMVESLLDVLLQTLLSIMSKSQSQEAXXXX
XXXXGEYVSCLLSLLRQMSDTHFQHLLDSFQSKEELKEFVLKILCVFRNLMKLSIFPRDW
NVMRLLTSNIIVSTARFLSPAIHKNFNEADFDFKVWSSYFGLAVLYINQPSLQLESLSPA
KRKKVLDKHGDMRIPMAYELLTMWQNLGENKVHFIPGMIGPFLGVTLVPQAEVRNIMIPL
FHDMMDWEQRTKGHFKQVEAELIDKLDSLVSEGKGDENYRELFSLLLLEKVEQETWRESG
ISFVTSVTRLMERLLDYRDCMKGDETENKKIGCTVNLLNFYKSHKEEMYIRYIHKLCDMY
LQADNYTAAFTLLLYWEQLSWEEGPLRDFLHYPAQTHWHRKEALCRKVLHYFNKAKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKMEAAYYDNIMEQQRLEPEFFRIGFYGRKFPFFLR
NKEFVCRGHDYERLEAFQQRMLGEFPQAIAMQHPNQPDEAILQCDAQYLQIYAVTPVPEN
LSVLQMERVPDRIKSFYRVNNVRRFRYDRPFHKGPKDKDNEFKSLWIERTTLILTHPLPG
ISRWFEVEKREL
Download sequence
Identical sequences ENSGMOP00000000042 ENSGMOP00000000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]