SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000052 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000052
Domain Number 1 Region: 258-420
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.54e-41
Family PLC-like (P variant) 0.00000994
Further Details:      
 
Domain Number 2 Region: 480-621
Classification Level Classification E-value
Superfamily ARM repeat 8.63e-41
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000202
Further Details:      
 
Domain Number 3 Region: 58-221
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-27
Family Ras-binding domain, RBD 0.00042
Further Details:      
 
Domain Number 4 Region: 631-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-26
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000482
Further Details:      
 
Domain Number 5 Region: 857-988
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.14e-24
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000052   Gene: ENSGMOG00000000049   Transcript: ENSGMOT00000000054
Sequence length 994
Comment pep:novel genescaffold:gadMor1:GeneScaffold_977:16300:24749:-1 gene:ENSGMOG00000000049 transcript:ENSGMOT00000000054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPEQYLLLYARGQEWYEMYDDCQVLRTLDVPWSRQADGRLAATIAVTPVAAADDGERQR
QQALLATLIGHDLDREATNRLGELMVTRRKLASPRRQELKLRDNVVYATEPWTTTAPLPR
DLQPHGDRSLKITLHYLQKLSFSMEVNPSITPQLLLELCNKVTADQGLECRPSDSLVLKV
TGREEFLSGDFRLLDFLWVRKCLKSSRDLHLSVLSVTQLPQEAVLLADWPLVDSFTGQSS
SHDDLRLEGKDLDDIFMISLWDCDRKFRFKLTGIDIPKLPAKAPPSVYVEASIIYGNKVL
LSVASTTKSFADEVLWNEWLEFSVLLSDLPRGAKLGLTVNACSNETASTPQKGKGGTLFF
VNLLLIDHRSLLSQGPYNLHMWPYLGQEGEVVTYQADRLSSATNPDVTHCMAISLLLDRY
SFPVVLPNGVCRPGHSCRSLPRPRQTRSTASSDAASRTPVSTSSTANADKAHLKRFGKEQ
SVHYTANLPTFLRSVDWLKRNVVEDVHWLLEHLEPEELDLSVALELLSFDSIDESVRRLV
VQRLESLSNDEVLMYLLQLVQTLKVEPYHDSFLACFLLQRALRSKRIGHFFFWYMRSEVA
ACPYFRQRMALVLEAYLLGCGQAMLDGFSLQVQAAQALQQVALQVKEMFPDKTDLPPTAS
GPCSAALQVQGLLERSDLPKEFLVPFDPRVKAGAILLKSCKVMASKKKPLWLEFQPMPSP
SPTPPLGILFKEGDDLRQDMLVLQTLVVMDSIWQEKSLDLNLVPYGCIATGHNIGMIEIV
RKAVTIAAVQRSEGGTHGAFKNDAIFNWLRGKCPLQEIXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNLFHIDFGHILGNRKSFLGVRRERVPFVLTPDFLYVIGGVKGRD
SLCIQRFKVRDICTEAYLSLHSQSRLLVTLFSLMLLTGIPELSAAEDMRYLREALQQERS
EEHARDHFLQQIATCENLGWTVQANWWIHMLVGI
Download sequence
Identical sequences ENSGMOP00000000052 ENSGMOP00000000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]