SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000087 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000087
Domain Number 1 Region: 455-630
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 610-707
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.25e-20
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 
Domain Number 3 Region: 774-902
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000221
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000087   Gene: ENSGMOG00000000082   Transcript: ENSGMOT00000000089
Sequence length 1201
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3509:88752:117998:-1 gene:ENSGMOG00000000082 transcript:ENSGMOT00000000089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWITPEEVLIANALWVSERANPFFILQRRKGHGKGGLLVGTMDVVLDSSARAAPYRILLQ
TGDSQVYWSIACGGSRMEITTHWEWLEANLLQTLSIFENDEDISTFVKGKISGIIAEENK
SKQAQEEEDSGKFREAELKMRKLFGMPEEEKLVNYYSCSFWKGRVPRQGWLYLTVNHICF
YSFLLGKEVTLISQWTDVTRLEKNATLLFPESVRVCTRDTEHFFSMFLNINDTFKLMEQL
ATIAMRQILDNEGFAADLSLPKPRKTLKNVSALKRDLDARAKNERYRTLFRLTQEERLDG
HTDCTLWAPFAKMHVTGQLFISNNYICFASREEDLCNLIIPLREVSVVEKADSSSVLPCP
VSISTKNKMNFLFANLKDRDFLVQRISDFLQRTPDRMWSDANASSSSPGPAVLPRPRHYH
PGLPTASQGLLHIYQRDDPEGQGPKAAKEKMKEESWKIHFFEFGRGVCMYRTSKTRELVL
NGLPECLRGELWLLFSGAQNEMATQPGYYGDLVEQAMGRCSLATEEIERDLHRSMPEHRA
FQNEMGIAALRRVLTAYAHRNPGIGYCQAMNIVASVLLLYCTEEEAFWLLVALCERMLPD
YYNTRVVGALVDQGVFEELTRACLPLLYEHMQELGVISSISLSWFLTLFLSVMPFDSAVL
LVDCFFFEGIKVIFQVALAVLHDNMDALLACNDEGEAMTILGRYLDNVVNKQTVSSPIPH
LHALLTSGDEPPPEIDVFDLIKSSYEKFGSLRSDVIEQMRFKQRLKVIQSLEDTAKRSVV
RAMMTESAFSIDELEELYCLFKAKHVMSCYWGLGGSAAADRHDPSLPYLEQYRIDLGQFC
QLFGALAPWRCGVHTPILAARLFRLLDRNKDGLVNFKEFVTGLSGMYHGDMTEKLKLLYK
LHLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDKVKDYKYYLRMWAKEKEPEKETIKDLPRMSQQEHFIELCKTLYNMFSEEGREQELYH
SIATVASLLLRIGEVAKKFTNHTTKNAKTLAPSPPPAAARPEGEESCGEGSSGQSQDVCK
ALADAQLDSLPPLQGSDEDGRDDTSVSSYSMVSTGSLQCDDITDDTVLIGCGGQRRGSVV
DSDWSITFEQMLASVLTEPPLVDYFEKKGDIQTKMAACKAQRNVERQTSSSSDHELAQNS
V
Download sequence
Identical sequences ENSGMOP00000000087 ENSGMOP00000000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]