SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000093 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000093
Domain Number 1 Region: 149-266
Classification Level Classification E-value
Superfamily FKBP-like 1.12e-35
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 2 Region: 274-384
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-33
Family FKBP immunophilin/proline isomerase 0.00027
Further Details:      
 
Domain Number 3 Region: 29-152
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-33
Family FKBP immunophilin/proline isomerase 0.00021
Further Details:      
 
Domain Number 4 Region: 360-490
Classification Level Classification E-value
Superfamily FKBP-like 1.63e-28
Family FKBP immunophilin/proline isomerase 0.0012
Further Details:      
 
Domain Number 5 Region: 497-573
Classification Level Classification E-value
Superfamily EF-hand 0.00000000416
Family Calbindin D9K 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000093   Gene: ENSGMOG00000000088   Transcript: ENSGMOT00000000095
Sequence length 588
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2466:67060:74773:-1 gene:ENSGMOG00000000088 transcript:ENSGMOT00000000095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRSRLSVATAASTYTMEFVVSLFLVLRFCDVVKCDSGPLIDVVVDRYDIPSVCPREVGT
EDFVRYHFNGTFFEGGKKFDSSHDRGNAFISQVGLGRMITGMDRGIMGMCVNERRKITIP
PHLAYGSIGTGGVIPPDAVLVFDILLLDIWSSDDKVQISTISKPEKCKRTVEASDYVRYH
YNGSLLSGTYIDTSFSSNKTYDTYVGKGDLIQGMEEGLLGMCVGERRIVVVPPFLGYGEK
GYGTKIPPQATLVFEVLLVDLFNTNDDMEVVNQASEDCTRKTVKGDYIRYHYNGTFLDGS
AFDSSYKRNSTYNTYIGMGYVILGMDRALQGLCIGERRRVVVPPHLAYGEQGVVFNVEDL
IPSSAVLVFDIDVIDFHNPKDPIEIKVTHKPKECNMTSEGDDMIQYRYNCSLMDGTLLYS
SWDHYDSAPITTLGANKVILGLDDGLKGMCVGEKREVIVPPHLGHGENGPPASGVPKSAV
LFFELELLSLSKGVPDGYMFVWLGDSPDPLFPAMDLNGDHEVPLEEFSAFIMIQVSELKG
RLRPGMDASVIIKDMFDNQDRDKDGKIVLDELKLKAEEDSDKARHEEL
Download sequence
Identical sequences ENSGMOP00000000093 ENSGMOP00000000093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]