SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000155 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000155
Domain Number 1 Region: 875-970
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-19
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 596-695
Classification Level Classification E-value
Superfamily Immunoglobulin 7.8e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 315-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000183
Family C1 set domains (antibody constant domain-like) 0.065
Further Details:      
 
Domain Number 4 Region: 687-782
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000266
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 807-883
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.037
Further Details:      
 
Domain Number 6 Region: 511-601
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000578
Family C1 set domains (antibody constant domain-like) 0.042
Further Details:      
 
Domain Number 7 Region: 222-310
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000818
Family I set domains 0.052
Further Details:      
 
Domain Number 8 Region: 46-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000953
Family I set domains 0.058
Further Details:      
 
Domain Number 9 Region: 119-178
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000414
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000155
Domain Number - Region: 420-487
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00154
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000155   Gene: ENSGMOG00000000141   Transcript: ENSGMOT00000000158
Sequence length 1079
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4598:376320:418196:1 gene:ENSGMOG00000000141 transcript:ENSGMOT00000000158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPPPGDSSSEXXXXXXXXXXXXXXXXXXXXXXXXXXXGVLRASGAVQWLKDGLLLGPQR
GLPGFPRYSIQGDPSRGQFHLQVERAELGDDGPYECQVGGSESSQPISSNLAWLDVLIPP
SEPYFEVASDEAWVAGRRYTVVCVAPDAKPEAQIQLYKDGVELMGVESSSETGSDERLWT
TRGEVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPRPPVIRGLEGDQVKAGS
VLRLVCVSQGGNTLAVLNWMKDGEVVTTSWGAPRATSSATLQIKVEPADNQAVFSCLSGD
VFPPVSRKITVIFEPAKVDVEGSYEVVEGDQLELLCVTTSSNPPVSIRWWLGSRELNASA
VTVREGEHGGSITTSNLTHLVSRDQDGLPLTCEAFNPGTRISKIRTESLIVLTPLGPGVP
LPRPLRSGTRVRLFCFSPGEHGTLTWLKVCVCVCVCVCGVSRELALVLVPGDNMAAYQCE
AGNEAGAVMSAETRLQVLFPAVSVRIVAQQERSRVGQTLGLQCLSGSSNPKANVSWILGA
RRIPGEEQPPRSAAFGGVSVSSSLALPLAQHNKQRLICQAYSAVLSEGASTFHTLDVMYP
PEFSPAQPRLVQVTEEDTAVLPLLVSANPEELTCTWLHHQDTLITARHLYQWYEDYSLQI
RNVTRRHAGKYTVQCTNEEGRRHTTITLDVLYSPGVRPKSAEVRVVLGAMADLICVADAN
PAAAFSWAWLGEGEMEFEEETMEEEFGVLTIQEVTRAHAGRYQCIADNGIAPPASAEVEL
VVCFGPEIKKGVQWSKVASRGDGSVEAEVLCRAEGIPPVSFSWDKNNVPMDFENPRYAER
TVRDGSFSTSTVVVLNVSALLDYALFTCHASNALGEDSLQIQLVSTNHPDPPSSVGLVGV
SYSSVTLEWIPGFNGGLAQSYRIRYHPTDSFTYVDVFPLSTAVYTVTNLAPSTTYNFSIA
ALNAIGESGYEDAASLVATTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSGGTAGDGSGRYESREKINAAAQRTLITDSGSETQSNVYESYGA
Download sequence
Identical sequences ENSGMOP00000000155 ENSGMOP00000000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]