SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000189 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000189
Domain Number 1 Region: 110-357
Classification Level Classification E-value
Superfamily vWA-like 1.22e-81
Family Integrin A (or I) domain 0.0000000097
Further Details:      
 
Domain Number 2 Region: 353-443
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-28
Family Integrin domains 0.0000159
Further Details:      
 
Domain Number 3 Region: 609-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.06e-16
Family Integrin beta tail domain 0.0000489
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000209
Family Plexin repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 568-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Integrin beta EGF-like domains 0.002
Further Details:      
 
Domain Number 6 Region: 525-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000189
Domain Number - Region: 492-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000189   Gene: ENSGMOG00000000186   Transcript: ENSGMOT00000000193
Sequence length 767
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2466:339336:353595:1 gene:ENSGMOG00000000186 transcript:ENSGMOT00000000193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSNICTTRGVSTCRQCLAISPKCAWCFQEGFGRGGSSLTRCDLRDLLLASGCDEASMEFP
SSSLTVVKDKPLSDKASGVADDVTQIKPQRIHMKLRPDDTQRFTVLVKQVEDYPVDLYYL
MDLSYSMIDDLATLRSLGNDLATAIGEKTSNLRMGFGAFVDKPMSPYMYIAPEEALKNPC
YGIKRNCLAQFGYKNVLSLTEQVARFTEEVGKQQVSRNRDSPEGGFDAIMQAAVCKEKIG
WRPDASHLLVFTTDAETHIALDGRLAGVVSPNDGLCHLDKSDVYDMSTLLDYPSLALMTD
KMSENNINLVFAVTNNVLPLYKNYSQLIPGTTVGILAGDSRNIVQLILEAYANIRSKVEL
ELLDVPEELALSFDATCLNGEVIPGFKSCSGLKIGDTVSFSVEARLRGCPKEKRRTFTIK
PRGFKDALEINVDFACGCACEAQAELDSPLCNQGNGTHECGVCQCHPGRLGPNCECSEGD
YSPTDDEKCSPDPKALTCSGRGECLCGQCACRRNDYGHVWGQYCECDDFSCTHFKGKQCS
GHGKCDCGICICYADWKGSNCNCSERVDTCMSTTGMRCSGRGHCLCGKCECTQVGAYGTT
CEKCPTCPDACTIKKDCVECKHFLRGPLSEDSETCARICKDEIEPVDKIINNLNAVNCSY
KDEKMKGCVEYFQYFEDASGKSILYVMKEPECPQGTAIWVVLLAVAVAVLFLGLAALLIW
KLWVTIVDRREFAKFNDERAKAKWDTANNPLYKGATSTFTNVTYRGK
Download sequence
Identical sequences ENSGMOP00000000189 ENSGMOP00000000189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]